Recombinant Bovine Thromboxane A2 receptor (TBXA2R)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant bovine TBXA2R is typically produced using:

Expression SystemTagPurityApplications
Mammalian cells (HEK293)His, Fc, Avi>90%Functional assays, structural studies
E. coliT7, Non~80%Antibody production, epitope mapping
Baculovirus-insect cellsGST>85%Kinase interaction studies

Data adapted from supplier specifications .

Functional Roles and Signaling Pathways

Recombinant bovine TBXA2R retains the canonical signaling functions observed in human orthologs:

  • G protein coupling: Activates Gαq/11 and Gα12/13 subfamilies, triggering downstream RhoA/ROCK and phospholipase C (PLC) pathways .

  • ERM protein activation: Phosphorylates ezrin, radixin, and moesin via RhoA-SLK/LOK cascades, promoting cytoskeletal remodeling critical for cell migration .

  • Pathological roles:

    • Enhances metastasis in triple-negative breast cancer (TNBC) by increasing cell motility and invasion .

    • Regulates platelet aggregation and vascular tone, implicating it in cardiovascular diseases .

4.1. Cancer Metastasis Studies

Recombinant bovine TBXA2R is used to model TNBC metastasis mechanisms. Key findings include:

  • TBXA2R activation increases ERM phosphorylation by 2–3 fold, driving 1.5× faster invasion in collagen matrices .

  • Knockout of moesin or SLK abolishes TBXA2R-induced metastasis in xenograft models .

4.2. Therapeutic Development

  • Antagonists: DG-041 and picotamide inhibit TBXA2R, reducing TNBC cell invasion by 60–70% in preclinical trials .

  • Biomarker potential: High TBXA2R expression correlates with poor survival in TNBC patients (HR = 2.1, p < 0.01) .

Comparative Analysis of TBXA2R Isoforms

IsoformLengthFunctionExpression System
TPα (Bovine)343 aaActivates adenylyl cyclase, pro-metastaticHEK293, E. coli
TPβ (Bovine)407 aaInhibits adenylyl cyclase, anti-apoptoticMammalian cells

Data derived from human isoforms , with inferred conservation in bovines.

Challenges and Future Directions

  • Species-specific differences: Bovine TBXA2R’s ligand-binding affinity may vary from human receptors, necessitating cross-validation .

  • Therapeutic targeting: Small-molecule inhibitors face challenges due to TBXA2R’s structural similarity to other prostanoid receptors .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, kindly indicate them in your order notes. We will do our best to accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is dependent on various factors including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
TBXA2R; Thromboxane A2 receptor; TXA2-R; Prostanoid TP receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MWPNASSLGPCFRPMNITLEERRLIASPWFAASFCLVGLASNLLALSVLMGARQGSSQSR SSFLTFLCGLVLTDFMGLLVTGAIVVTQHFVLFEWQAVDPGCSLCHFMGVIMVFFGLCPL LLGAAMASERFLGITRPFSRPATASQRRAWTTVGLVWASALALGLLPLLGVGHYTVQYPG SWCFLTLGTDPGDVAFGLLFALLGSISVGMSFLLNTISVATLCHVYHGQATAQQRPRDCE VEMMVQLMGIMVVASICWMPLLVFIAQTVLQSPPAMSPTGQLSRLTERQLLIYLRVATWN QILDPWVYILFRRAVIQRFYPRLSTRSRSLSLQPQLTRRSTIH
Uniprot No.

Target Background

Function
The Thromboxane A2 receptor (TBXA2R) serves as a receptor for thromboxane A2 (TXA2), a potent stimulator of platelet aggregation. The receptor's activity is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. In the kidney, the binding of TXA2 to glomerular TP receptors triggers intense vasoconstriction. The receptor activates phospholipase C and adenylyl cyclase.
Gene References Into Functions
  1. Thromboxane A2 receptor activation via PKC-zeta-mediated NAD(P)H oxidase activation increases superoxide and peroxynitrite, resulting in eNOS uncoupling in endothelial cells. PMID: 20947827
Database Links

KEGG: bta:538783

STRING: 9913.ENSBTAP00000019892

UniGene: Bt.4053

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic molecular structure of bovine Thromboxane A2 receptor?

The bovine Thromboxane A2 receptor (TBXA2R) is a G protein-coupled receptor (GPCR) characterized by a heptahelical (seven transmembrane domain) structure consisting of 343 amino acids. Molecular cloning studies have revealed that the bovine TBXA2R shares significant homology with human TBXA2R variants, specifically 84.0% homology with human placental and 81.4% with human endothelial variants. This evolutionary conservation indicates the fundamental importance of this receptor across species .

The receptor contains critical structural motifs common to Class A GPCRs, including the highly conserved NPXXY motif in the seventh transmembrane domain (TMD7) and functionally important residues in TMD1 that are necessary for proper receptor trafficking and signaling .

What are the primary signaling pathways activated by bovine TBXA2R?

The bovine TBXA2R primarily couples to two distinct G-protein signaling pathways:

  • cAMP pathway: Upon agonist binding, the receptor couples to stimulatory G-proteins, leading to activation of adenylyl cyclase and subsequent increases in intracellular cAMP levels .

  • G protein subfamilies: TBXA2R signaling involves both Gαq/11 and Gα12/13 subfamilies. Experimental evidence shows differential coupling efficiency, with U-46619 (a TBXA2R agonist) demonstrating potencies of 24.0 nM via Gα12 and 0.93 nM via Gα13 .

The receptor's activation triggers downstream effectors including the small GTPase RhoA and its Ser/Thr kinase effector SLK, which subsequently activates ERM (Ezrin, Radixin, Moesin) proteins that regulate cytoskeletal organization .

How does bovine TBXA2R compare with the human receptor in terms of pharmacological properties?

While structurally similar, bovine and human TBXA2R exhibit distinct pharmacological properties:

PropertyBovine TBXA2RHuman TBXA2RNotes
Amino acid homology100% (reference)84.0% (placenta), 81.4% (endothelium)Conservation in key functional domains
Binding affinity for SQ 29548 (antagonist)Kd = 12.6±1.1 nMVariable by tissue typeDetermined by radioligand binding studies
Binding affinity for U46619 (agonist)Kd = 192.1±58.9 nMVariable by tissue typeHigher affinity in bovine compared to some human tissue variants
Prostaglandin selectivityNo binding to PGD2, PGE1, PGF2αSimilar selectivity profileDemonstrates receptor specificity

The bovine TBXA2R serves as an excellent model for studying eicosanoid signaling due to these well-characterized pharmacological properties .

What are effective methods for expressing recombinant bovine TBXA2R in cell culture systems?

Successful expression of functional recombinant bovine TBXA2R requires careful consideration of expression systems and methodological approaches:

  • Cell Line Selection: COS-7 cells have been successfully used for transfection and expression of bovine TBXA2R cDNA, providing a reliable platform for binding and functional studies . Other mammalian cell lines such as HEK293 can also be utilized, particularly for loss-of-function experiments and BRET (Bioluminescence Resonance Energy Transfer) assays .

  • Transfection Protocol:

    • Isolate bovine TBXA2R cDNA from appropriate sources (e.g., bovine heart cDNA library)

    • Clone into a mammalian expression vector with a strong promoter

    • Optimize transfection conditions using either calcium phosphate precipitation, lipofection, or electroporation

    • Verify expression through immunoblotting, immunofluorescence, or functional assays

  • Verification Approaches:

    • Radioligand binding using [³H]SQ 29548 to confirm receptor expression

    • Competitive binding assays with unlabeled antagonists (SQ 29548) and agonists (U46619)

    • Functional assays measuring cAMP production or calcium mobilization

For studying signaling dynamics, transient transfection may be sufficient, while stable cell lines should be developed for long-term studies requiring consistent receptor expression levels .

How can researchers effectively measure bovine TBXA2R activation and signaling in experimental settings?

Multiple complementary techniques allow for comprehensive assessment of TBXA2R activation and downstream signaling:

  • Radioligand Binding Assays:

    • Preparation of cell membrane fractions from TBXA2R-expressing cells

    • Incubation with [³H]SQ 29548 (specific TBXA2R antagonist)

    • Competition with increasing concentrations of unlabeled ligands

    • Analysis using Scatchard plots for Kd determination (e.g., Kd = 12.6±1.1 nM for SQ 29548)

  • BRET-Based Conformational Biosensors:

    • Utilization of enhanced bystander BRET (ebBRET) biosensors to monitor receptor activation

    • Fusion of Renilla luciferase (rLucII) to the C-terminus of target proteins

    • Targeting of Renilla GFP (rGFP) to the plasma membrane using CAAX motifs

    • Measurement of energy transfer upon receptor conformational changes

  • G-Protein Coupling Assays:

    • Direct measurement of G-protein activation using BRET2 assays

    • Analysis of downstream second messengers (cAMP, Ca²⁺)

    • Comparative assessment of coupling to different G-protein subfamilies (e.g., Gα12 vs. Gα13)

  • Functional Cellular Assays:

    • Migration assays (e.g., wound healing/scratch assay)

    • Invasion assays using Matrigel-coated chambers

    • Cytoskeletal reorganization assessment via immunofluorescence

These methods enable quantitative assessment of receptor pharmacology and signaling dynamics under various experimental conditions.

How do naturally occurring mutations in TBXA2R affect receptor function, and what can these teach us about structure-function relationships?

Naturally occurring variants in TBXA2R provide valuable insights into critical residues and domains essential for proper receptor function:

  • NPXXY Motif Variants:

    • The c.190G>A variant (causing Asp304Asn substitution) in the highly conserved NPXXY motif of TMD7 significantly impairs ligand binding

    • This suggests the NPXXY motif, beyond its known role in stabilizing receptor inactive states, may be crucial for maintaining ligand binding pocket integrity

  • TMD1 Variants and Receptor Trafficking:

    • Trp29Cys substitution reduces surface receptor expression without affecting total receptor levels, indicating defective trafficking

    • Asn42Ser substitution causes receptor retention in the trans-Golgi network/endoplasmic reticulum compartment

    • Both variants highlight TMD1's critical role in proper receptor folding and anterograde trafficking

  • Dimerization Effects:

    • Both Trp29Cys and Asn42Ser variants impair receptor dimerization

    • Heterozygous expression of these variants can exert dominant-negative effects on wild-type receptor function through impaired homodimerization

VariantLocationFunctional EffectClinical Association
Asp304AsnTMD7 (NPXXY motif)Reduced ligand bindingBleeding tendency
Trp29CysTMD1Reduced surface expressionAbnormal post-surgical bleeding
Asn42SerTMD1Intracellular retentionSignificant post-operative and mucocutaneous bleeding

These structure-function insights can guide rational design of TBXA2R mutants for research purposes and enhance understanding of naturally occurring receptor dysfunction .

What are the methodological approaches for investigating TBXA2R polymorphisms and their functional consequences?

Comprehensive investigation of TBXA2R polymorphisms requires a multifaceted approach:

  • Genetic Screening and Identification:

    • Next-generation sequencing of TBXA2R gene from patients with relevant phenotypes

    • PCR amplification and direct sequencing of coding regions

    • Comparison with reference sequences to identify variants

  • In Silico Analysis:

    • Prediction of variant effects using computational tools (SIFT, PolyPhen)

    • Homology modeling to predict structural alterations

    • Conservation analysis across species to identify evolutionarily constrained residues

  • Functional Characterization:

    • Site-directed mutagenesis to recreate variants in expression constructs

    • Transient transfection in appropriate cell models

    • Analysis of:

      • Surface expression by flow cytometry or immunofluorescence

      • Ligand binding using radioligand binding assays

      • Signal transduction via second messenger assays

      • Protein-protein interactions through co-immunoprecipitation or BRET

      • Subcellular localization with confocal microscopy

  • Dominant-Negative Effect Assessment:

    • Co-expression of wild-type and variant receptors in defined ratios

    • Measurement of receptor dimerization using BRET or FRET approaches

    • Determination of functional readouts in the presence of both receptor forms

These methodologies allow for comprehensive characterization of variant effects on receptor biology from molecular to cellular levels.

How can researcher's design experiments to investigate the role of TBXA2R in thrombosis and hemostasis regulation?

Investigating TBXA2R in thrombosis and hemostasis requires specialized experimental approaches:

  • In Vitro Platelet Function Studies:

    • Platelet aggregometry in response to TBXA2R agonists (U46619)

    • Flow cytometry to assess platelet activation markers (P-selectin, activated GPIIb/IIIa)

    • Calcium mobilization assays in isolated platelets

    • Microfluidic flow chamber assays replicating physiological shear conditions

  • Ex Vivo Blood Vessel Studies:

    • Wire myography of isolated blood vessels to measure contractile responses

    • Perfusion studies in isolated vessel segments

    • Thrombus formation under flow conditions with fluorescently labeled platelets

  • In Vivo Thrombosis Models:

    • Ferric chloride-induced vascular injury

    • Laser-induced microvascular injury with intravital microscopy

    • Comparison of wild-type and TBXA2R-deficient animals

    • Pharmacological intervention with specific TBXA2R antagonists (SQ 29548)

  • Transgenic Approaches:

    • Generation of knock-in models expressing specific TBXA2R variants

    • Tissue-specific conditional knockout models

    • Humanized mouse models expressing human TBXA2R variants

  • Clinical Correlation:

    • Genotype-phenotype correlation in patients with bleeding disorders

    • Platelet function testing in individuals with known TBXA2R variants

    • Response to antiplatelet therapies based on TBXA2R genotype

These approaches enable comprehensive understanding of TBXA2R's role in normal hemostasis and pathological thrombosis.

What methodological considerations are important when investigating TBXA2R's role in cancer cell metastasis?

Investigation of TBXA2R in cancer metastasis requires specialized approaches addressing both molecular mechanisms and functional outcomes:

  • Receptor Expression Analysis:

    • Quantification of TBXA2R expression in cancer cell lines and patient samples

    • Correlation of expression levels with clinical outcomes and metastatic potential

    • Single-cell analysis to identify TBXA2R-expressing subpopulations

  • Signaling Pathway Dissection:

    • Systematic knockdown/inhibition of pathway components:

      • G-protein subtypes (Gαq/11, Gα12/13)

      • Small GTPases (RhoA)

      • Downstream kinases (SLK)

      • ERM proteins

    • Phosphorylation analysis of key pathway components

    • Temporal dynamics of signaling activation

  • Functional Assays:

    • Migration assays:

      • Wound healing/scratch assays (e.g., Oris™ system)

      • Transwell migration assays

      • Time-lapse microscopy for single-cell tracking

    • Invasion assays:

      • Matrigel-coated transwell chambers

      • 3D spheroid invasion models

    • Cytoskeletal dynamics:

      • Live-cell imaging of actin dynamics

      • Immunofluorescence for ERM activation and localization

  • In Vivo Metastasis Models:

    • Tail vein injection models (e.g., Hs578T cells in NSG mice)

    • Orthotopic implantation models

    • Quantification parameters:

      • Metastatic nodule size and number

      • Organ-specific tumor burden

      • Histopathological analysis of serial sections

  • Therapeutic Targeting Approaches:

    • TBXA2R antagonist treatment (SQ 29548)

    • Pathway-specific inhibitors

    • RNA interference or CRISPR-based gene editing

    • Combination approaches with standard therapies

Research has demonstrated that TBXA2R activation via U46619 significantly increases triple-negative breast cancer cell motility (~1.5-fold) and enhances metastatic nodule size and liver tumor burden in mouse xenograft models, highlighting the importance of these methodological considerations .

How can bovine TBXA2R research be translated to human health applications, and what are the key species differences to consider?

Translating bovine TBXA2R research to human applications requires careful consideration of similarities and differences:

Researchers should validate key findings across species and consider species-specific differences in receptor regulation, post-translational modifications, and protein-protein interactions when translating findings .

What experimental techniques enable effective comparative studies between bovine and human TBXA2R variants?

Comparative studies between bovine and human TBXA2R variants require specialized methodological approaches:

  • Parallel Expression Systems:

    • Cloning and expression of both bovine and human TBXA2R variants in identical cell backgrounds

    • Generation of chimeric receptors to identify species-specific functional domains

    • Creation of point mutations to convert bovine-specific residues to human counterparts and vice versa

  • Comparative Pharmacological Profiling:

    • Radioligand binding assays with standardized conditions across species variants

    • Dose-response curves for shared agonists (U46619) and antagonists (SQ 29548)

    • Calculation of binding and potency parameters (Kd, EC50) for cross-species comparison

  • Signaling Pathway Analysis:

    • BRET-based G-protein coupling assays for different G-protein subfamilies

    • Quantification of second messenger production (cAMP, Ca²⁺)

    • Phosphorylation analysis of downstream effectors

  • Structural Biology Approaches:

    • Homology modeling based on crystal structures of related GPCRs

    • Molecular dynamics simulations to identify species-specific conformational differences

    • Cryo-EM or X-ray crystallography of purified receptors

  • Functional Genomics:

    • CRISPR-based genome editing to humanize bovine cells or bovinize human cells

    • Cross-species transcriptomic analysis following receptor activation

    • Identification of species-specific interacting partners

These approaches enable systematic identification of conserved and divergent aspects of TBXA2R biology across species, facilitating appropriate translation of bovine research findings to human applications.

What are common challenges in generating functional recombinant bovine TBXA2R, and how can researchers overcome them?

Researchers frequently encounter specific challenges when working with recombinant bovine TBXA2R:

  • Low Expression Levels:

    • Challenge: TBXA2R often exhibits low surface expression in heterologous systems

    • Solution: Optimize codon usage for expression host; incorporate N-terminal signal sequences; use expression enhancers like chaperone co-expression; consider inducible expression systems with titratable induction

  • Protein Misfolding and Retention:

    • Challenge: GPCRs frequently misfold and become retained in the ER/Golgi

    • Solution: Culture cells at reduced temperature (30-32°C); add chemical chaperones (DMSO, glycerol); optimize detergent selection for membrane preparation; use fusion partners known to enhance folding (e.g., T4 lysozyme)

  • Ligand Binding Characterization:

    • Challenge: Achieving sufficient signal-to-noise ratio in binding assays

    • Solution: Optimize membrane preparation protocols; increase specific activity of radioligands; reduce non-specific binding through buffer optimization; consider alternative detection methods like fluorescence-based ligand binding

  • Functional Coupling Assessment:

    • Challenge: Variable coupling efficiency to different G-protein subtypes

    • Solution: Co-express appropriate G-protein subunits; use chimeric G-proteins to enhance coupling; implement BRET-based proximity assays; utilize pathway-specific biosensors

  • Dominant Negative Effects:

    • Challenge: Expression of variant receptors may interfere with wild-type function

    • Solution: Use inducible expression systems; carefully titrate expression levels; implement single-cell analysis approaches; develop receptor subtype-selective tools

Systematic optimization of these parameters enhances the likelihood of successfully generating functional recombinant bovine TBXA2R for experimental applications.

How can researchers address data inconsistencies when studying TBXA2R signaling across different experimental systems?

Data inconsistencies across experimental systems are common in TBXA2R research and require systematic troubleshooting:

  • Source of Variability Identification:

    • Cell type-specific differences in G-protein and effector expression

    • Receptor expression level variations affecting signal amplification

    • Differences in experimental conditions (temperature, buffer composition)

    • Variations in ligand quality and purity

  • Standardization Approaches:

    • Implement internal controls for normalization across experiments

    • Quantify receptor expression levels via flow cytometry or western blotting

    • Use reference compounds with established potencies in each experiment

    • Perform systematic concentration-response analyses rather than single-point measurements

  • Conflicting Data Resolution Strategies:

    • Cross-validate findings using multiple complementary techniques

    • Systematically vary experimental parameters to identify critical variables

    • Implement genetic approaches (siRNA, CRISPR) to confirm specific pathway involvement

    • Consider the temporal dynamics of signaling events

  • System-Specific Considerations:

    • Recombinant Systems: Control receptor density; confirm G-protein coupling

    • Primary Cells: Account for donor variability; characterize endogenous receptor levels

    • In Vivo Models: Consider strain differences; control for circadian variations

    • Patient Samples: Account for medication effects; document clinical parameters

  • Advanced Reconciliation Approaches:

    • Develop mathematical models integrating data across systems

    • Implement systems biology approaches to map pathway interconnections

    • Consider receptor heterogeneity (splice variants, post-translational modifications)

    • Account for functional selectivity of different ligands

This systematic approach enables researchers to address data inconsistencies and develop more robust models of TBXA2R signaling across experimental systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.