Recombinant Bovine TM2 domain-containing protein 2 (TM2D2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TM2D2; TM2 domain-containing protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-214
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
TM2D2
Target Protein Sequence
HNATAEPELTSAGAAHPEGSPGAASWEYGDPHSPVILCSYLPDEFIECEDPVDHVGNTTA FQELGYGCLKFGGQAYRDVEHTRVQCRALDGIECASPRTFLRENKPCIKYTGHYFITTLL YSFFLGCFGVDRFCLGHTGTAVGKLLTLGGLGIWWFVDLILLITGGLMPSDGSNWCTIY
Uniprot No.

Target Background

Database Links
Protein Families
TM2 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of bovine TM2D2?

Bovine TM2D2 (also known as BLP1) is a 214-amino acid protein that contains a structural module related to the seven transmembrane domain G protein-coupled receptor superfamily. The protein features two putative transmembrane domains in its C-terminal half, a DRY motif, and conserved cysteines and lysines that are characteristic of G protein-coupled receptors . TM2D2 shares structural similarities with beta-amyloid binding protein (BBP), though unlike BBP, it does not regulate responses to beta-amyloid peptide .

What are the known functions of TM2D2?

TM2D2 appears to have regulatory roles in cell death or proliferation signal cascades . Research in Drosophila models indicates that TM2D2 (ortholog amaretto/CG11103) functions in the Notch signaling pathway, with knockout studies revealing maternal-effect neurogenic defects . The protein family shows conservation across metazoans, suggesting fundamental biological importance . Current evidence indicates TM2D2 may function in concert with other TM2D family proteins (TM2D1 and TM2D3) in cellular signaling processes .

How is TM2D2 expression distributed in tissues?

Northern blot analysis has detected variable expression of a 1.35-kb BLP1 transcript in all human tissues examined . This widespread expression pattern suggests TM2D2 plays a role in fundamental cellular processes rather than tissue-specific functions. Researchers studying bovine TM2D2 should consider this broad expression profile when designing experiments to investigate tissue-specific roles or modifications.

What methods are available for detecting and quantifying bovine TM2D2?

For quantitative detection of bovine TM2D2 in experimental samples, sandwich ELISA represents a reliable methodology. The bovine TM2D2 ELISA employs antibodies specific for TM2D2 that have been pre-coated onto microplates. The assay follows a sequential procedure:

  • Samples are added to wells where any TM2D2 present binds to immobilized antibodies

  • After washing, biotin-conjugated antibodies specific for TM2D2 are introduced

  • Streptavidin-conjugated Horseradish Peroxidase (HRP) is added

  • A substrate solution generates color proportional to the amount of bound TM2D2

  • The reaction is stopped and color intensity is measured

This approach enables precise quantification of bovine TM2D2 across various experimental conditions.

How should recombinant bovine TM2D2 be optimally stored and handled?

Based on general principles for recombinant protein handling (as specific instructions for bovine TM2D2 were not provided in the search results), researchers should consider:

  • Storage at -80°C for long-term preservation, with aliquoting to prevent freeze-thaw cycles

  • Maintaining appropriate buffer conditions to ensure protein stability

  • Conducting pilot studies to determine optimal working concentrations for specific applications

  • Validating protein activity before use in critical experiments

  • Including appropriate controls when using recombinant TM2D2 in experimental systems

What expression systems are recommended for producing recombinant bovine TM2D2?

When selecting an expression system for recombinant bovine TM2D2, researchers should consider the protein's structural characteristics. Since TM2D2 contains transmembrane domains , expression systems capable of proper membrane protein folding and post-translational modifications are preferable. Options include:

  • Mammalian expression systems (e.g., HEK293, CHO cells) for maintaining native folding and modification patterns

  • Insect cell systems (e.g., Sf9, High Five) for membrane proteins requiring complex processing

  • Yeast systems (e.g., Pichia pastoris) as an alternative for transmembrane proteins

Selection should be guided by the specific experimental requirements and downstream applications.

How can CRISPR/Cas9 technology be applied to study TM2D2 function?

CRISPR/Cas9-mediated genome editing has proven effective for investigating TM2D genes. In Drosophila models, researchers generated clean null alleles of all three TM2D genes using CRISPR/Cas9-mediated homology directed repair (HDR) . This approach could be adapted for bovine cell lines or model organisms to:

  • Generate precise knockout models of bovine TM2D2

  • Create point mutations mimicking naturally occurring variants

  • Introduce epitope tags for protein localization studies

  • Develop conditional knockout systems to study temporal aspects of TM2D2 function

Results from Drosophila studies indicate that knockout of TM2D2 ortholog (amaretto) produces phenotypes similar to those observed with TM2D3 ortholog (almondex) deletion, suggesting functional cooperation . Similar approaches in bovine systems could reveal species-specific aspects of TM2D2 function.

What is the relationship between TM2D2 and Notch signaling pathways?

Drosophila studies have established a functional connection between TM2D proteins and Notch signaling. The TM2D family appears to be involved in the γ-secretase cleavage step of Notch processing. Overexpression of the most conserved region of TM2D proteins acts as a potent inhibitor of Notch signaling at this step .

For bovine TM2D2 researchers, this suggests several investigative directions:

  • Examining whether bovine TM2D2 similarly modulates Notch pathway activity

  • Investigating potential protein-protein interactions between TM2D2 and γ-secretase components

  • Exploring if TM2D2 functions upstream or downstream of Notch receptor cleavage

  • Analyzing tissue-specific effects of TM2D2 on Notch-dependent processes in bovine cells

These investigations could utilize co-immunoprecipitation, proximity ligation assays, or reporter systems to quantify Notch pathway activity.

What multi-factor experimental designs are recommended for studying TM2D2 interactions?

When designing experiments to investigate TM2D2 interactions with other cellular components or pathways, multi-factor experimental designs are valuable for capturing complex relationships. Key considerations include:

  • Accounting for blocking factors to control unwanted variation in experimental settings

  • Including appropriate replication to enable detection of interaction effects between factors

  • Verifying that assumptions of analytical models (e.g., equal variance) are met through residual analysis

  • Considering log-transformation of data if variance heterogeneity is detected

For example, when studying TM2D2's potential roles in cellular signaling, a factorial design might include:

  • Factor 1: TM2D2 expression level (knock-down, wild-type, overexpression)

  • Factor 2: Cellular stress conditions (normal, oxidative stress, ER stress)

  • Factor 3: Cell type or tissue origin

This approach allows for detection of conditional effects that might be missed in simpler experimental designs.

What is known about TM2D2's potential role in neurodegenerative conditions?

  • TM2D2 shares structural similarities with TM2D3, which has established links to Alzheimer's disease

  • Drosophila models demonstrate that all three TM2D genes produce similar neurogenic phenotypes when knocked out

  • The TM2D protein family modulates Notch signaling, which plays crucial roles in neural development and maintenance

Researchers could investigate bovine TM2D2's relevance to neurodegeneration through:

  • Comparative studies between bovine and human TM2D2

  • Examination of TM2D2 expression in bovine neuronal cell models under neurodegenerative conditions

  • Analysis of TM2D2 interactions with established neurodegeneration-related proteins

How conserved is TM2D2 function across species?

TM2D proteins are highly conserved across metazoans, with each species typically encoding three separate TM2D genes . This conservation suggests fundamental biological importance. In Drosophila, the triple knockout of all TM2D genes produces phenotypes similar to single gene knockouts, suggesting these genes function together in conserved pathways .

For bovine TM2D2 researchers, comparative studies might assess:

  • Sequence homology between bovine TM2D2 and orthologs in other species

  • Conservation of critical functional domains and motifs

  • Whether bovine TM2D2 can rescue phenotypes in knockout models of other species

  • Similarities and differences in tissue expression patterns across species

These analyses could provide insight into evolutionarily conserved functions versus species-specific adaptations.

What are the key challenges in producing functional recombinant bovine TM2D2?

As a protein containing transmembrane domains , recombinant production of bovine TM2D2 presents several technical challenges:

  • Ensuring proper membrane insertion and folding in expression systems

  • Avoiding protein aggregation during purification

  • Maintaining functional conformation in solution

  • Determining appropriate detergent conditions if solubilization is required

  • Verifying biological activity of the purified recombinant protein

Researchers should consider using fusion tags (e.g., His-tag, GST) to facilitate purification while minimizing interference with protein function, and conduct pilot studies to optimize expression conditions.

How can multi-factor analysis be applied to TM2D2 functional studies?

When investigating TM2D2 functions across multiple conditions or contexts, researchers should employ robust multi-factor analytical approaches. Important considerations include:

  • Properly accounting for non-independence in experimental designs

  • Using appropriate statistical models that can handle interaction effects

  • Implementing log-transformation when data show heterogeneity of variance

  • Carefully interpreting p-values as strength of evidence rather than binary significance indicators

For example, when analyzing TM2D2's effects on cellular processes across multiple cell types and treatment conditions, researchers should:

  • Ensure adequate replication across all factor combinations

  • Test assumptions of analytical models using diagnostic plots

  • Consider mixed-effects models if experimental units are nested

What protein interaction methods are most suitable for studying TM2D2?

Given TM2D2's structure as a transmembrane protein, specialized approaches for membrane protein interactions are recommended:

  • Membrane yeast two-hybrid systems that enable detection of interactions in membrane environments

  • Proximity-based labeling techniques (BioID, APEX) to identify interactions in native cellular contexts

  • Co-immunoprecipitation with appropriate detergent conditions to preserve interactions

  • FRET or BiFC approaches for monitoring interactions in living cells

These methods can help elucidate TM2D2's potential interactions with Notch pathway components or other signaling molecules, as suggested by studies of TM2D family proteins in Drosophila .

Comparative Table of TM2D Family Proteins

FeatureTM2D1TM2D2 (BLP1)TM2D3
Drosophila orthologbiscotti (CG10795)amaretto (CG11103)almondex (amx)
Protein domain structureContains TM2 domainContains TM2 domain, 214 amino acids, 2 transmembrane domainsContains TM2 domain
Knockout phenotype in DrosophilaMaternal-effect neurogenic defectMaternal-effect neurogenic defectMaternal-effect neurogenic defect
Relationship to Notch signalingInvolved in Notch pathwayInvolved in Notch pathwayRequired for embryonic Notch signaling
Association with diseaseNot directly establishedNot directly establishedRare variants associated with Alzheimer's disease
ConservationConserved across metazoansConserved across metazoansConserved across metazoans

Based on information from

What novel approaches could advance understanding of bovine TM2D2 function?

Emerging technologies that could enhance bovine TM2D2 research include:

  • Single-cell transcriptomics to identify cell populations with high TM2D2 expression

  • Cryo-EM structural studies to determine precise protein conformation and interaction surfaces

  • Organoid models to examine TM2D2 function in complex tissue-like environments

  • Proteomic profiling to identify TM2D2 interaction partners and post-translational modifications

  • In silico molecular dynamics simulations to predict functional consequences of sequence variants

These approaches could reveal previously unrecognized aspects of TM2D2 biology and suggest new therapeutic or biotechnological applications.

How might cross-species comparative studies enhance understanding of TM2D2?

Systematic comparison of TM2D2 across species could provide valuable insights into:

  • Evolutionarily conserved functional domains essential to protein activity

  • Species-specific adaptations or specializations

  • Differential tissue expression patterns that correlate with species-specific physiology

  • Variability in post-translational modifications and their functional consequences

Studies in Drosophila have already demonstrated the value of model organisms for understanding TM2D protein function , and extension to bovine and other mammalian systems could further illuminate conserved mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.