Recombinant Bovine Trans-2,3-enoyl-CoA reductase (TECR)

Shipped with Ice Packs
In Stock

Description

General Information

TECR, also known as trans-2-enoyl-CoA reductase, belongs to the zinc-containing alcohol dehydrogenase family . It is a homodimer that catalyzes the reduction of trans-2-enoyl-CoA to acyl-CoA in an NADPH-dependent manner, with a preference for medium chain-length substrates ranging from C6 to C16 . TECR is involved in the mitochondrial synthesis of fatty acids .

Expression and Localization

TECR is highly expressed in skeletal and heart muscle, with lower expression levels in the placenta, liver, kidney, and pancreas, and weak or no expression in the lung . At the cellular level, TECR localizes to the mitochondrion . In mouse brains, TECR colocalizes with zonula occludens-1 (Zo-1), a blood vessel marker, suggesting its critical role for endothelial cells in forming functional barriers during blood-brain barrier (BBB) development .

Role in Blood-Brain Barrier (BBB) Homeostasis

Lipid metabolism in cerebrovascular endothelial cells (ECs) regulates blood-brain barrier (BBB) maturation and homeostasis . Studies show that trans-2-enoyl-CoA reductase (Tecr) is highly expressed during barriergenesis and decreases after BBB maturation . EC-specific knockout of Tecr compromises angiogenesis due to delayed vascular sprouting and also leads to loss of the restrictive quality of vascular permeability from neonatal stages to adulthood, with high levels of transcytosis, while maintaining vascular tight junctions .

Impact on Omega-3 Fatty Acids

The expression of Tecr in ECs is associated with the content of omega-3 fatty acids, which directly suppresses caveolae vesicles formation . Lipidomic analysis revealed that omega-3 FAs were dramatically decreased after Tecr knockdown . Tecr is a key controller in omega-3 FAs metabolism and is essential for the maturation and maintenance of BRB and BBB .

Association with Neurological Disorders

Mutations in the TECR gene are associated with autosomal recessive mental retardation . Research indicates that TECR variants can cause a mixed phenotype of long QT and Catecholaminergic Polymorphic Ventricular Tachycardia (CPVT type 3) .

Product Specs

Form
Lyophilized powder
Lead Time
Delivery time varies depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TECR; GPSN2; Very-long-chain enoyl-CoA reductase; Synaptic glycoprotein SC2; Trans-2,3-enoyl-CoA reductase; TER
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TECR
Target Protein Sequence
MKHYEVEILDAKTREKLCFLDKVEPQATIAEIKNLFTKTHPQWYPARQSLRLDPKGKSLK DEDVLQKLPVGTTATLYFRDLGAQISWVTVFLTEYAGPLFIYLLFYFRVPFIYGRKYDFT SSRHTVVHLACICHSFHYIKRLLETLFVHRFSHGTMPLRNIFKNCTYYWGFAAWMAYYIN HPLYTPPTYGAQQVKLALAIFVICQLGNFSIHMALRDLRPAGSKTRKIPYPTRNPFTWLF LLVSCPNYTYEVGSWIGFAIMTQCLPVALFSLVGFTQMTIWAKGKHRSYLKEFRDYPPLR MPIIPFLL
Uniprot No.

Target Background

Function

Recombinant Bovine Trans-2,3-enoyl-CoA reductase (TECR) plays a crucial role in both very long-chain fatty acid (VLCFA) production for sphingolipid synthesis and the degradation of the sphingosine moiety in sphingolipids via the sphingosine 1-phosphate metabolic pathway. It catalyzes the final step in the four-reaction VLCFA elongation cycle, an endoplasmic reticulum-bound process that adds two carbons to the long- and very long-chain fatty acyl-CoA per cycle. TECR reduces the trans-2,3-enoyl-CoA fatty acid intermediate to an acyl-CoA, enabling further elongation. This contributes to the production of VLCFAs of varying chain lengths, which serve as precursors for membrane lipids and lipid mediators. Furthermore, TECR catalyzes the saturation step in the sphingosine 1-phosphate pathway, converting trans-2-hexadecenoyl-CoA to palmitoyl-CoA.

Database Links
Protein Families
Steroid 5-alpha reductase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Bovine Trans-2,3-enoyl-CoA Reductase (TECR) and how does it function in fatty acid metabolism?

Bovine Trans-2,3-enoyl-CoA Reductase (TECR), also known as TER (EC 1.3.1.38), is an essential enzyme involved in the fatty acid elongation pathway. It catalyzes the fourth and final reaction in the fatty acid elongation cycle, specifically the NADPH-dependent reduction of trans-2-enoyl-CoA to form acyl-CoA . This reaction is critical for the biosynthesis of very long chain fatty acids (VLCFAs) in bovine cells.

The enzyme functions by catalyzing the reduction of the trans-2 double bond of trans-2-enoyl-CoA, similar to the activity characterized in other 2-enoyl thioester reductases involved in fatty acid synthesis . TECR possesses a putative non-classical NADPH-binding site that is essential for its catalytic function, typically located at its C-terminus .

How does Bovine TECR differ from TECRL (Trans-2,3-enoyl-CoA reductase-like)?

While both proteins share similarity in their names and general functions, there are several key differences:

FeatureBovine TECRBovine TECRL
UniProt IDQ3ZCD7Q3SZ89
Alternative NamesTER, Synaptic glycoprotein SC2Steroid 5-alpha-reductase 2-like 2 protein
Gene SynonymsGPSN2SRD5A2L2
Protein Length308 amino acids363 amino acids
EC Number1.3.1.381.3.1.- (not fully classified)
FunctionWell-characterized role in fatty acid elongationSimilar but potentially distinct enzymatic properties

The amino acid sequences show differences that may reflect functional specialization, with TECR being more directly involved in the mainstream fatty acid elongation pathway, while TECRL may have evolved to perform related but specialized functions in lipid metabolism .

What expression systems are suitable for recombinant production of bovine TECR?

Several expression systems have been successfully employed for the recombinant production of bovine TECR, each with specific advantages:

E. coli expression systems:

  • Advantages: Rapid growth, high protein yields, well-established protocols

  • Considerations: May lack proper post-translational modifications; transmembrane domains can cause solubility issues

Yeast expression systems:

  • Advantages: Eukaryotic post-translational modifications, good for membrane proteins

  • Considerations: Yield may be lower than E. coli; glycosylation patterns differ from mammalian cells

Baculovirus/insect cell systems:

  • Advantages: Superior for complex eukaryotic proteins, better folding of mammalian proteins

  • Considerations: More time-consuming and expensive than bacterial systems

Mammalian cell expression:

  • Advantages: Most authentic post-translational modifications and protein folding

  • Considerations: Highest cost, lower yields, technically more demanding

For functional studies, the choice of expression system should be guided by the specific experimental requirements. If enzymatic activity studies are planned, insect or mammalian cell systems may be preferable as they better maintain native protein conformation and activity .

What are the optimal experimental designs for characterizing the enzymatic activity of recombinant bovine TECR?

Experimental characterization of bovine TECR activity requires careful design considerations:

Spectrophotometric Assays:

  • Monitor NADPH oxidation at 340 nm to directly observe enzyme activity

  • Reaction buffer typically includes:

    • 100 mM potassium phosphate buffer (pH 7.0-7.4)

    • 0.1-1 mM trans-2-enoyl-CoA substrate

    • 0.1-0.5 mM NADPH

    • 1-5 μg purified recombinant TECR

  • Measure decrease in absorbance at 340 nm over time to calculate activity

Substrate Specificity Studies:

  • Test various chain length trans-2-enoyl-CoA substrates (C4-C24)

  • Compare kinetic parameters (Km, Vmax) to determine substrate preference

  • Include appropriate controls (heat-inactivated enzyme, no substrate)

Confirmation of Product Formation:

  • Use GC-MS or LC-MS to verify reaction products

  • This is particularly important when evaluating the effect of mutations on enzyme function

Experimental Design Considerations:

  • Include both positive and negative controls in each experiment

  • Perform reactions at physiologically relevant temperatures (37°C for bovine enzymes)

  • Establish linearity of the assay with respect to time and enzyme concentration

  • Consider using a factorial design to evaluate multiple variables simultaneously

What strategies should be employed for studying the structure-function relationship of bovine TECR through site-directed mutagenesis?

Site-directed mutagenesis is a powerful approach for investigating the structure-function relationship of TECR. Based on related enzymes, the following strategies are recommended:

NADPH-Binding Site Analysis:

  • Identify putative NADPH-binding residues based on sequence alignments with related reductases

  • Create alanine substitution mutants for conserved residues, particularly those with the motif G(5X)IPXG which may represent a novel NADPH-binding motif

  • Express and purify these mutants using the same conditions as the wild-type enzyme

  • Compare enzymatic activities to determine critical residues

Experimental Validation Workflow:

  • Generate mutant constructs using PCR-based mutagenesis

  • Verify mutants by DNA sequencing

  • Express wild-type and mutant proteins in parallel

  • Confirm protein expression levels by Western blotting

  • Purify proteins using affinity chromatography

  • Perform enzymatic assays under identical conditions

  • Analyze substrate binding using isothermal titration calorimetry or fluorescence-based assays

  • Verify structural integrity using circular dichroism spectroscopy

Complementation Studies:
For functional validation, yeast complementation studies can be particularly informative:

  • Transform TECR-deficient yeast strains with wild-type or mutant bovine TECR

  • Monitor growth on selective media

  • Analyze fatty acid profiles using GC-MS to determine if the mutant can restore normal VLCFA production

How can researchers troubleshoot solubility and purification challenges with recombinant bovine TECR?

Membrane-associated proteins like TECR often present solubility challenges that require specific strategies:

Solubility Enhancement Approaches:

  • Tag optimization:

    • N-terminal vs. C-terminal His-tag placement can significantly affect solubility

    • Some proteins rescued to soluble form by changing tag position from C-terminus to N-terminus

  • Fusion partners:

    • SUMO, GFP, or GB1 (B1 domain of streptococcal protein G) can improve solubility

    • These fusion partners can be removed post-purification using specific proteases

  • Expression conditions:

    • Lowering temperature (16-18°C) during induction

    • Using specialized E. coli strains (Rosetta, Arctic Express)

    • Adjusting inducer concentration and induction time

Purification Optimization:

  • If transmembrane domains are predicted, consider removing them from the construct design

  • For proteins expressed in insect cells, replacing native signal peptides with honeybee melittin signal can improve processing

  • During lysis, use appropriate detergents (0.5-1% Triton X-100, n-dodecyl β-D-maltoside, or CHAPS)

  • Include glycerol (10-20%) in purification buffers to stabilize the protein

  • Immobilized metal affinity chromatography (IMAC) using magnetic beads can be effective for initial screening of expression conditions

Retention of Enzymatic Activity:

  • Monitor activity throughout purification process

  • Include stabilizing agents (glycerol, reducing agents) in storage buffers

  • Consider storage in 50% glycerol at -20°C for extended periods

What are the most effective approaches for analyzing the role of bovine TECR in fatty acid metabolism pathways?

To comprehensively analyze TECR's role in fatty acid metabolism, researchers should consider these methodological approaches:

Metabolic Profiling:

  • Compare fatty acid profiles in systems with normal vs. altered TECR expression

  • Use GC-MS or LC-MS for comprehensive analysis of fatty acid chain lengths and saturation levels

  • Focus on very long chain fatty acids (C22-C26) which are most likely to be affected by TECR function

Integrated Pathway Analysis:

  • Study TECR in the context of the complete fatty acid elongation system

  • Consider potential interactions with other enzymes in the pathway

  • Analyze flux through the pathway using stable isotope labeling approaches

Experimental Design Considerations:

  • Use a true experimental design with appropriate controls

  • Consider between-subjects or within-subjects designs depending on your specific research question

  • Control for extraneous variables that might influence fatty acid metabolism

  • Develop specific, testable hypotheses about TECR's role

Data Analysis Framework:

  • Apply multivariate statistical methods to analyze complex lipid profiles

  • Use principal component analysis to identify patterns in fatty acid composition

  • Consider pathway enrichment analysis to identify affected metabolic networks

How does the quaternary structure of recombinant bovine TECR influence its enzymatic properties?

The quaternary structure of TECR plays an important role in its enzymatic function:

Structural Considerations:

  • TECR proteins typically function as dimers or tetramers

  • Proper oligomerization is often critical for enzymatic activity

  • Expression systems can influence quaternary structure formation

Analytical Methods:

  • Size exclusion chromatography to determine native molecular weight

  • Blue native PAGE to analyze oligomeric state

  • Analytical ultracentrifugation for precise determination of quaternary structure

  • Cross-linking studies to confirm protein-protein interactions

Functional Implications:

  • Mutations that disrupt oligomerization may produce properly folded monomers that lack activity

  • Co-expression of interaction partners may be necessary for proper folding and activity

  • Consider analyzing both the oligomeric state and activity in parallel when characterizing mutants

What advanced experimental designs are most appropriate for studying the regulation of bovine TECR expression and activity?

Understanding TECR regulation requires sophisticated experimental approaches:

Transcriptional Regulation Studies:

  • Promoter analysis using reporter gene assays

  • ChIP-seq to identify transcription factors binding to the TECR promoter

  • CRISPR-based approaches to modify endogenous regulatory elements

Post-Translational Modification Analysis:

  • Phosphoproteomic analysis to identify regulatory phosphorylation sites

  • Mass spectrometry to identify other modifications (acetylation, ubiquitination)

  • Site-directed mutagenesis of putative modification sites to determine functional significance

Environmental Regulation:

  • Design factorial experiments to test the effects of multiple variables (e.g., hormones, nutrients) on TECR expression and activity

  • Consider both independent variables (manipulated factors) and dependent variables (measured outcomes)

  • Control for extraneous and confounding variables that might affect results

  • Use appropriate statistical approaches to analyze complex interactions

Example Experimental Matrix Design:

Treatment Factor 1Treatment Factor 2Measured Outcomes
Insulin levels (0, 1, 10 nM)Fatty acid availability (low, medium, high)TECR expression, TECR activity, VLCFA production
Temperature (33°C, 37°C, 41°C)Oxygen levels (hypoxic, normoxic)Protein stability, enzymatic kinetics
Developmental stageTissue typeExpression patterns, isoform distribution

This type of factorial design allows for the systematic investigation of how multiple factors interact to regulate TECR function .

How can recombinant bovine TECR be applied in broader research contexts beyond basic enzymatic characterization?

Recombinant bovine TECR has applications across multiple research domains:

Comparative Biochemistry:

  • Use bovine TECR as a model to understand TECR function across species

  • Compare enzymatic properties with TECR from other organisms to identify species-specific adaptations

  • Study evolutionary conservation of structure-function relationships

Agricultural Research:

  • Investigate the role of TECR in milk fat synthesis and composition

  • Analyze how TECR activity affects fatty acid profiles in bovine tissues

  • Consider implications for milk quality and animal health

Biomedical Applications:

  • Understand the role of TECR in lipid-related disorders

  • Use bovine TECR as a model for studying human TECR-related diseases

  • Develop screening assays for compounds that modulate TECR activity

Biotechnological Applications:

  • Engineer TECR variants with modified substrate specificity

  • Incorporate TECR into synthetic biology pathways for production of specialized lipids

  • Use TECR in conjunction with other enzymes for biocatalytic applications

Future Research Directions:

  • Structural studies to determine the three-dimensional structure of bovine TECR

  • Systems biology approaches to understand TECR's role in lipid homeostasis

  • Development of specific inhibitors or activators as research tools

  • Investigation of potential roles beyond fatty acid elongation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.