Recombinant Bovine Translocator protein (TSPO)

Shipped with Ice Packs
In Stock

Description

Functional Roles

TSPO is implicated in multiple cellular processes, many conserved in bovine systems:

Cholesterol Transport and Steroidogenesis

  • Facilitates cholesterol translocation across mitochondrial membranes, a rate-limiting step in steroid hormone synthesis .

  • Controversially, TSPO-knockout models in mice showed retained steroidogenesis, suggesting compensatory mechanisms .

Mitochondrial Homeostasis

  • Regulates mitochondrial respiration, membrane potential, and reactive oxygen species (ROS) production .

  • Modulates mitochondrial permeability transition pore (mPTP) opening, influencing apoptosis .

Neurosteroid Production

  • Ligand-bound TSPO enhances neurosteroid synthesis (e.g., allopregnanolone), with implications for neuroprotection .

Expression Systems

  • Bacterial Systems: E. coli is widely used for high-yield TSPO production, though lacking post-translational modifications .

  • Mammalian Systems: HEK293 or CHO cells enable proper folding and ligand-binding activity .

Key Research Applications

ApplicationFindingsReferences
Ligand Binding StudiesPK11195 and DPA-714 show high affinity for recombinant TSPO .
Structural AnalysisCrystal structures reveal ligand-binding pockets and cholesterol interaction sites .
Drug DevelopmentTSPO-targeting ligands explored for neuroinflammation imaging and therapy .

Controversies and Unresolved Questions

  • Essentiality in Steroidogenesis: While pharmacological studies link TSPO to steroid production, genetic knockouts challenge its indispensability .

  • Species-Specific Variations: Bovine TSPO may exhibit distinct ligand-binding kinetics compared to human or rodent isoforms .

Future Directions

  • Structural Dynamics: Cryo-EM studies to resolve conformational changes during cholesterol transport .

  • Therapeutic Targeting: Development of TSPO ligands for neurodegenerative diseases and cancer .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preferred format in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance for arrangements. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form can be stored for up to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use to minimize repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
TSPO; BZRP; Translocator protein; Isoquinoline-binding protein; IBP; PKBS; Peripheral-type benzodiazepine receptor; PBR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MAPPWVPAVGFTLLPSLGGFLGAQYTRGEGFRWYASLQKPPWHPPRWILAPIWGTLYSAM GYGSYMIWKELGGFSKEAVVPLGLYAGQLALNWAWPPLFFGTRQMGWALVDLLLTGGMAA ATAMAWHQVSPPAACLLYPYLAWLAFAGMLNYRMWQDNQVRRSGRRLSE
Uniprot No.

Target Background

Function
Translocator protein (TSPO) facilitates cholesterol transport across mitochondrial membranes and may be involved in lipid metabolism. However, its precise physiological role remains under investigation. It is not believed to be essential for steroid hormone biosynthesis. TSPO can bind protoporphyrin IX and potentially plays a role in porphyrin and heme transport. Initially identified as a peripheral-type benzodiazepine receptor, TSPO also binds isoquinoline carboxamides.
Database Links
Protein Families
TspO/BZRP family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein.

Q&A

What is bovine TSPO and how does its sequence compare to human TSPO?

Bovine TSPO is an 18 kDa protein primarily localized in the outer mitochondrial membrane that functions as a high-affinity cholesterol-binding protein. While no direct comparison data is available specifically for bovine TSPO, mammalian TSPO proteins show significant conservation. Human and mouse TSPO genes both translate to 169-amino acid proteins with 81% sequence homology . TSPO is evolutionarily conserved across species, with human TSPO showing 33.5% identity to bacterial TSPO from Rhodobacter sphaeroides . Researchers should note this conservation when designing experiments comparing bovine and human TSPO functions.

What expression systems provide optimal yields for recombinant bovine TSPO?

When expressing recombinant bovine TSPO, researchers should consider:

  • Bacterial systems (E. coli): Most commonly used due to simplicity and cost-efficiency, but may lack post-translational modifications

  • Yeast systems: Provide eukaryotic post-translational modifications

  • Mammalian cell lines: Offer most authentic processing but with lower yields

For proper folding of membrane proteins like TSPO, specialized strains containing additional chaperones may improve yield and quality. Expression should be optimized by testing multiple induction conditions (temperature, inducer concentration) and detergents for extraction, as TSPO's membrane localization makes purification challenging.

How can researchers verify proper folding and functionality of recombinant bovine TSPO?

Functional verification of recombinant bovine TSPO should employ multiple approaches:

  • Ligand binding assays: Using established TSPO ligands such as PK11195 or Ro5-4864 to confirm binding capacity

  • Circular dichroism: To assess secondary structure elements

  • Functional reconstitution: Testing cholesterol transport activity in artificial membrane systems

  • Comparative binding studies: Between recombinant and native TSPO using radiolabeled ligands

Researchers should validate activity using TSPO-specific antagonists like PK11195, which has been shown to abolish the effects of TSPO ligands in experimental models .

How should researchers interpret contradictory findings regarding TSPO's role in steroidogenesis?

ApproachEarlier FindingsRecent FindingsPotential Explanation
Cell-based studiesTSPO knockdown inhibited steroidogenesis>80% TSPO knockdown showed no adverse effects on steroid productionOff-target effects or cell-specific responses
Genetic knockoutReported embryonic lethality of Tspo−/− miceTspo−/− mice viable with normal steroidogenesisMethodological issues in earlier knockout attempts
PharmacologicalTSPO ligands stimulate steroid productionTSPO ligands stimulate steroid production in both Tspo intact and knockout cellsOff-target effects of TSPO ligands

Researchers should recognize that the effect of TSPO ligands like PK11195 on steroidogenesis appears to be mediated through TSPO-independent mechanisms, as these compounds similarly increase steroid hormone production in both Tspo-intact and Tspo-knockout MA-10 cells . When working with bovine TSPO, researchers should conduct parallel studies with appropriate controls to distinguish TSPO-specific from non-specific effects.

What methodological approaches can resolve the heterogeneity in TSPO research findings?

The heterogeneity of findings in TSPO research may stem from several factors that researchers should systematically address:

  • Antibody specificity: Use highly specific antibodies and validate with knockout controls. Earlier studies using polyclonal antisera may have detected non-specific epitopes .

  • Ligand selectivity: TSPO-binding chemicals may interact with alternate targets. Researchers should validate findings with genetic approaches .

  • Cell type differences: TSPO expression is regional and cell-type specific within tissues .

  • Experimental conditions: Standardize protocols for:

    • Subcellular fractionation

    • Ligand binding assays

    • Activity measurements

    • Protein-protein interaction studies

  • Genetic background: Consider species differences and genetic variability when comparing results across studies.

When designing experiments with bovine TSPO, researchers should implement rigorous controls and multiple complementary approaches to avoid the pitfalls evident in previous contradictory findings.

How do TSPO ligands affect steroid production in models of aging and hypogonadism?

TSPO ligands have demonstrated potential for stimulating steroid production in models of decreased steroidogenic capacity. In aged Brown Norway rats (21 months old), treatment with TSPO drug ligands FGIN-1-27 and Ro5-4864 stimulated testosterone production by primary Leydig cells in vitro at levels equivalent to young adult rats (3 months old) .

In vivo administration of FGIN-1-27 (1 mg/kg body weight) daily for 10 days significantly increased serum testosterone levels in both young and aged rats compared to controls. Notably, treatment elevated testosterone in aged rats to levels comparable with untreated young rats . The study reported no changes in body weight during treatment, suggesting no cytotoxic effects at this dosage .

These findings suggest potential therapeutic applications for TSPO ligands in addressing age-related declines in steroid production or primary hypogonadism, which researchers could explore in bovine models.

What are the methodological considerations for studying TSPO in neurological contexts?

When studying TSPO in neurological contexts, researchers should consider:

  • Ligand selection: Various TSPO ligands may have different binding affinities and functional effects. For example, dipeptide GD-102 (N-phenylpropionyl-l-tryptophanyl-l-leucine amide) has shown pronounced anxiolytic activity at doses of 0.01-0.5 mg/kg intraperitoneally in mice .

  • Stereochemical considerations: The activity of TSPO ligands can be highly dependent on their stereochemistry. The L,D-diastereomer of GD-102 shows no activity, while the D,L-isomer displays less pronounced activity than the L,L form .

  • Functional validation: Use TSPO antagonists like PK11195 as controls to confirm TSPO-mediated effects .

  • Imaging considerations: When using TSPO as a biomarker in PET imaging, researchers must account for:

    • Choice of tracer and kinetic model

    • Genotyping of subjects (for human studies)

    • Diurnal effects

    • Medication interference (particularly antipsychotics)

  • Species differences: Findings from rodent models may not directly translate to bovine or human contexts.

How can researchers disambiguate direct TSPO effects from off-target effects of TSPO ligands?

Disambiguating direct TSPO effects from off-target effects requires rigorous experimental design:

  • Genetic validation: Use TSPO knockout models alongside wild-type controls when testing ligand effects. Studies have shown that TSPO ligands like PK11195 increase steroid production similarly in both TSPO-intact and TSPO-knockout cells, indicating off-target mechanisms .

  • Concentration-response studies: Test wide concentration ranges to identify potential off-target effects at higher concentrations.

  • Competitive binding studies: Use multiple structurally diverse TSPO ligands and antagonists to confirm binding specificity.

  • Structure-activity relationship analyses: Systematically modify ligand structures to identify pharmacophore elements and correlate with functional outcomes. For example, dipeptide TSPO ligands lose anxiolytic activity when the C-amide group is replaced with methyl ester, free carboxyl, or methylamide groups .

  • Cross-validation approaches: Combine biochemical, cellular, and in vivo models to confirm consistent TSPO-dependent effects.

What are the optimal conditions for long-term storage of recombinant bovine TSPO?

Recombinant TSPO, being a membrane protein, requires careful handling to maintain structural integrity and function. Researchers should consider:

  • Detergent selection: Use mild detergents at concentrations just above critical micelle concentration

  • Stabilizing additives: Include glycerol (10-20%) and cholesterol

  • Storage temperature: Compare -80°C (flash-frozen aliquots), -20°C, and 4°C stability

  • Lyophilization potential: Test with appropriate cryoprotectants

  • Functional verification: Regularly perform binding assays to confirm retained activity

Testing multiple conditions in parallel with functional validation at various time points will help establish optimal protocols specific to bovine TSPO.

How might findings about TSPO function in rodents translate to bovine systems?

When translating TSPO research from rodent to bovine systems, researchers should consider several factors:

  • Evolutionary conservation: Despite 81% sequence homology between human and mouse TSPO , functional differences may exist between species.

  • Tissue distribution: TSPO expression patterns may differ across species. In mammals, TSPO is expressed in heart, brain, lung, spleen, testis, ovary, adrenal, kidney, bone marrow, salivary gland, adipose tissue, skin, and liver , but relative expression levels may vary between bovine and rodent tissues.

  • Pharmacological responses: TSPO ligands that show effects in rodents, such as FGIN-1-27 increasing testosterone in aged rats , may have different potencies or efficacies in bovine systems.

  • Species-specific protein interactions: The protein interactome of TSPO may differ between species, affecting functional outcomes.

  • Metabolism and pharmacokinetics: TSPO ligands may be metabolized differently across species, affecting in vivo studies.

Comparative studies directly examining differences between rodent and bovine TSPO would help establish appropriate translational frameworks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.