Recombinant Bovine Translocon-associated protein subunit gamma (SSR3)

Shipped with Ice Packs
In Stock

Description

Functional Role in Protein Translocation and ER Stress

SSR3 ensures efficient translocation of proteins with suboptimal signal peptides (SPs), particularly those enriched in glycine (G) and proline (P) residues . Mechanistically:

  • TRAP-Sec61 Interaction: SSR3 stabilizes the Sec61 translocon, enhancing SP recognition and translocation initiation .

  • ER Stress Regulation: SSR3 modulates phosphorylation of the ER stress sensor IRE1α, influencing susceptibility to chemotherapies like paclitaxel (PTX) .

Oncology

SSR3 expression correlates with chemosensitivity in breast cancer and glioblastoma:

  • Positive Correlation: Higher SSR3 levels predict better PTX response in glioma xenografts (Pearson r = 0.97, P = 0.02) .

  • Genetic Modulation: Knockout (KO) of SSR3 in PTX-sensitive cells (e.g., H4 glioma, MDA-MB-468 breast cancer) confers resistance, while overexpression sensitizes resistant cells .

Congenital Disorders

Mutations in SSR3 disrupt TRAP complex stability, leading to congenital disorders of glycosylation (CDG) . For example, the frameshift variant p.Glu93Valfs*7 causes:

  • Loss of SSR3 and reduced SSR1/SSR4 levels .

  • Abnormal glycosylation of GP130 and ICAM1, confirmed in fibroblast models .

Experimental Applications and Protocols

Recombinant SSR3 is utilized in:

  • Western Blot (WB): Dilution range 1:5,000–1:50,000 .

  • Immunofluorescence (IF-P): Dilution range 1:50–1:500 .

ApplicationRecommended DilutionDetected Tissues
WB1:5,000–1:50,000HeLa cells, mouse testis, rat testis
IF-P1:50–1:500Mouse brain tissue

Clinical and Therapeutic Implications

SSR3 is a biomarker candidate for PTX susceptibility in breast cancer and glioblastoma . Prospective clinical trials (e.g., NCT04528680) aim to validate its predictive utility .

Evolutionary Conservation and Relevance to Bovine Studies

While direct bovine SSR3 data is limited, structural and functional conservation across mammals is evident:

  • Placental Development: Murine SSR3 KO models show vascular malformations and embryonic lethality, underscoring its role in developmental biology .

  • TRAP Complex Stability: Bovine SSR3 likely shares the human homolog’s role in maintaining TRAP integrity, essential for glycosylation and ER homeostasis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, serving as a reference point for your consideration.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SSR3; Translocon-associated protein subunit gamma; TRAP-gamma; Signal sequence receptor subunit gamma; SSR-gamma
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MAPKGGPKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAV LYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDER ILWKKNEVADYEATTFSIFYNNTLFLVLVIVASFFILKNFNPTVNYILSISASSGLIALL STGSK
Uniprot No.

Target Background

Function
TRAP proteins are components of a complex responsible for binding calcium to the ER membrane. This interaction regulates the retention of ER resident proteins.
Database Links
Protein Families
TRAP-gamma family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of Translocon-associated protein subunit gamma (SSR3)?

SSR3 functions as a crucial component of the translocon associated protein (TRAP) complex, which facilitates the translocation of proteins across the endoplasmic reticulum membrane. The TRAP complex works in association with the oligosaccharyl transferase (OST) complex to maintain proper glycosylation of nascent polypeptides. SSR3 plays a significant role in maintaining the structural integrity of the entire TRAP complex, as demonstrated by studies showing that loss of SSR3 results in destabilization of other complex components, including SSR1 and SSR4 .

Research methodology: To investigate SSR3 function, researchers typically use complementation studies in SSR3-deficient cells. For example, primary fibroblasts from patients with SSR3 mutations can be transfected with either empty vectors or wild-type SSR3 cDNA. After 48 hours of recovery, western blot analysis of SSR1-4 proteins is performed to assess TRAP complex integrity .

How does SSR3 contribute to the stability of the TRAP complex?

SSR3 serves as a critical structural component of the TRAP complex, with its absence leading to comprehensive destabilization of the entire complex. Studies have demonstrated that frameshift variants resulting in loss of functional SSR3 protein cause not only the complete absence of SSR3 but also substantial reduction in SSR1 and SSR4 protein levels. This indicates that SSR3 plays a fundamental role in maintaining the structural integrity and proper assembly of the TRAP complex .

Experimental approach: Western blot analysis of TRAP complex components (SSR1-4) in cells with and without functional SSR3 is the standard method to assess this relationship. Complementation studies using wild-type SSR3 cDNA to restore TRAP complex integrity provide confirmatory evidence of SSR3's role in complex stability .

What experimental methods are used to detect SSR3 expression in bovine tissues?

Methodology for SSR3 detection in bovine tissues:

  • RNA extraction and qRT-PCR: Total RNA is isolated from bovine tissue samples using standard RNA extraction kits. Real-time quantitative PCR with SSR3-specific primers can quantify expression levels across different tissues.

  • Protein extraction and western blotting: Tissue homogenates are prepared in appropriate lysis buffers containing protease inhibitors. Western blot analysis using antibodies specific to bovine SSR3 allows for protein level detection.

  • Immunohistochemistry: Tissue sections are fixed, embedded, and stained with anti-SSR3 antibodies to visualize the spatial distribution of SSR3 in different bovine tissues.

  • Mass spectrometry: For detailed protein characterization, LC-MS/MS analysis of immunoprecipitated SSR3 or complex proteomics approaches can be employed.

Researchers should normalize expression to appropriate housekeeping genes or proteins when comparing across tissues or experimental conditions .

How do mutations in SSR3 contribute to Congenital Disorders of Glycosylation (CDG)?

Pathogenic variants in SSR3 disrupt the normal function of the TRAP complex, which plays a critical role in protein translocation and glycosylation. The specific mechanistic pathway involves:

  • TRAP complex destabilization: Mutations in SSR3, such as the frameshift variant c.278_281delAGGA [p.Glu93Valfs*7], lead to complete loss of SSR3 protein and partial loss of other TRAP complex components (SSR1 and SSR4) .

  • Glycosylation abnormalities: The destabilized TRAP complex cannot properly associate with the oligosaccharyl transferase (OST) complex, leading to impaired glycosylation of newly synthesized proteins .

  • Glycoprotein markers: Analysis of marker glycoproteins such as GP130 and ICAM1 in patient fibroblasts confirms abnormal glycosylation patterns, which can be detected through western blot analysis showing altered migration patterns of these proteins .

Additionally, the TRAP complex is linked to the ER-associated degradation (ERAD) pathway, with all SSR subunits dramatically upregulated during ER stress conditions. Loss of SSR3 may compromise this stress response pathway, further contributing to disease pathology by delaying clearance of unfolded proteins .

Research methodology: To study the relationship between SSR3 mutations and CDG, investigators should use a combination of genetic analysis (exome sequencing), biochemical assays of glycosylation (including carbohydrate-deficient transferrin testing), and functional studies in patient-derived fibroblasts or model cell lines with engineered SSR3 mutations .

What experimental approaches can be used to study the interaction between recombinant bovine SSR3 and other components of the TRAP complex?

Advanced experimental approaches for studying SSR3-TRAP interactions:

  • Co-immunoprecipitation (Co-IP): Using antibodies against bovine SSR3 to pull down the protein along with its interacting partners, followed by western blot analysis or mass spectrometry to identify associated TRAP complex components.

  • Proximity ligation assays (PLA): This technique can visualize protein-protein interactions in situ by generating fluorescent signals when two proteins are in close proximity (<40 nm).

  • Bimolecular fluorescence complementation (BiFC): By tagging SSR3 and potential interacting partners with complementary fragments of a fluorescent protein, interactions can be visualized when the fragments come together to form a functional fluorophore.

  • Cross-linking mass spectrometry (XL-MS): Chemical cross-linking of proteins in their native state, followed by mass spectrometry analysis, can identify interacting domains and structural relationships within the TRAP complex.

  • Cryo-electron microscopy: For detailed structural analysis of the assembled TRAP complex, including the positioning and interactions of SSR3.

  • CRISPR/Cas9-mediated genome editing: Creating precise mutations in SSR3 to study their effects on TRAP complex assembly and function .

How can researchers effectively design experiments to investigate SSR3's role in cancer drug susceptibility?

Recent research has identified SSR3 as a putative biomarker for paclitaxel (PTX) susceptibility in cancer treatment. To investigate this role, researchers should consider the following experimental design approaches:

  • Genome-wide CRISPR knockout screening:

    • Design a library targeting all human genes

    • Treat cells with paclitaxel at appropriate concentrations

    • Identify genes whose knockout confers resistance or sensitivity

    • Validate candidates including SSR3 through individual knockout experiments

  • Clinical correlation validation:

    • Analyze expression data from patient cohorts treated with paclitaxel versus other chemotherapies

    • Use Cox Proportional-Hazards Model to correlate SSR3 expression with treatment outcomes

    • Validate findings across independent patient cohorts

  • Cell line validation experiments:

    • Test multiple cancer cell lines with varied SSR3 expression levels for paclitaxel sensitivity

    • Create SSR3 knockout and overexpression models using CRISPR/Cas9 and lentiviral systems

    • Measure drug response using cell viability assays (MTT, CellTiter-Glo)

    • Establish dose-response curves and calculate IC50 values

  • In vivo validation:

    • Develop xenograft models with varied SSR3 expression levels

    • Test paclitaxel response in these models

    • Correlate tumor growth inhibition with SSR3 expression

  • Mechanistic studies:

    • Investigate the relationship between SSR3 and ER stress pathways

    • Analyze phosphorylation of IRE1α in relation to SSR3 expression

    • Use phospho-specific antibodies and western blotting to measure changes in signaling pathways

This multi-faceted approach ensures robust validation of SSR3's role in determining paclitaxel susceptibility and provides mechanistic insights into how SSR3 influences drug response.

How should researchers approach the investigation of conflicting data regarding SSR3 function?

When encountering conflicting results regarding SSR3 function across different experimental systems or publications, researchers should implement a systematic approach to resolution:

  • Critical evaluation of methodological differences:

    • Compare experimental designs, including cell types/tissues used, species differences (human vs. bovine SSR3), and expression systems

    • Assess differences in analytical techniques and their sensitivity/specificity

    • Evaluate statistical approaches and sample sizes

  • Sequential validation strategy:

    • Reproduce key experiments from conflicting studies using standardized protocols

    • Test hypotheses in multiple model systems (different cell lines, primary cells, animal models)

    • Employ complementary techniques to measure the same outcome

  • Integrative data analysis:

    • Use mixed methods approaches that combine quantitative and qualitative data

    • Consider the possibility that apparent contradictions may represent context-dependent functions of SSR3

    • Look for patterns or conditions that explain differential findings

  • Technical validation of reagents:

    • Validate antibody specificity through knockout controls

    • Sequence verify all expression constructs

    • Test multiple siRNA/shRNA sequences to rule out off-target effects

  • Collaborative resolution:

    • Engage with authors of conflicting studies

    • Consider joint experiments with standardized protocols and blinded analysis

This structured approach transforms apparent contradictions into opportunities for deeper understanding of SSR3's context-dependent functions and regulation .

What are the optimal conditions for expressing and purifying recombinant bovine SSR3?

Expression and purification protocol for recombinant bovine SSR3:

  • Expression system selection:

    • Bacterial systems: E. coli BL21(DE3) can be used for expressing non-glycosylated domains of SSR3

    • Eukaryotic systems: Insect cells (Sf9, High Five) or mammalian cells (HEK293, CHO) are preferred for full-length SSR3 with proper folding and post-translational modifications

  • Expression construct design:

    • Include a signal sequence for proper membrane insertion

    • Add affinity tags (His6, FLAG, or GST) for purification

    • Consider TEV or PreScission protease sites for tag removal

    • Optimize codon usage for the expression system

  • Expression conditions:

    • For bacterial systems: Induce at OD600 0.6-0.8 with 0.1-0.5 mM IPTG at 16-18°C overnight

    • For insect cells: Harvest 48-72 hours post-infection

    • For mammalian cells: Harvest 48-72 hours post-transfection

  • Membrane protein extraction:

    • Lyse cells in buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl, protease inhibitors

    • Solubilize membranes using detergents such as DDM (n-Dodecyl β-D-maltoside), LMNG, or digitonin at concentrations just above their CMC

  • Purification strategy:

    • Affinity chromatography using the introduced tag

    • Size exclusion chromatography to separate aggregates and obtain homogeneous protein

    • Consider ion exchange chromatography as an additional purification step

  • Quality control:

    • SDS-PAGE and western blotting to confirm purity and identity

    • Mass spectrometry for accurate molecular weight and post-translational modification analysis

    • Circular dichroism to assess proper folding

What experimental controls are essential when studying the effects of SSR3 mutations on glycosylation?

When investigating the impact of SSR3 mutations on glycosylation pathways, researchers must implement the following essential controls:

  • Genetic controls:

    • Wild-type SSR3: Include cells expressing normal SSR3 as a positive control

    • Empty vector: Use vector-only transfected cells as a negative control

    • Complementation control: Re-express wild-type SSR3 in mutant cells to confirm phenotype rescue

    • Alternative mutations: Include known pathogenic and benign variants to establish a spectrum of effects

  • Biochemical controls:

    • Known glycosylation substrates: Include well-characterized glycoproteins such as GP130 and ICAM1 as reporter proteins

    • N-glycosylation inhibitor control: Treat wild-type cells with tunicamycin as a positive control for glycosylation defects

    • Glycosidase treatments: Use PNGase F and Endo H treatments to confirm the glycan nature of observed mobility shifts

  • Analytical controls:

    • Loading controls: Use housekeeping proteins not affected by glycosylation

    • Molecular weight markers: Include precisely sized markers for accurate migration analysis

    • Inter-assay controls: Include reference samples across different experiments to normalize variation

  • Functional controls:

    • Other TRAP complex subunits: Monitor levels of SSR1, SSR2, and SSR4 to assess complex integrity

    • ER stress markers: Measure BiP, CHOP, and XBP1 splicing to evaluate secondary effects

    • Cell viability controls: Ensure observed effects are not due to cell death or stress

These controls collectively ensure that observed glycosylation phenotypes are specifically attributable to SSR3 mutations rather than experimental artifacts or secondary cellular responses.

How can researchers design experiments to differentiate between SSR3's role in protein translocation versus glycosylation?

Differentiating between SSR3's functions in protein translocation and glycosylation requires carefully designed experiments that can separate these interconnected processes:

  • Substrate-specific translocation assays:

    • In vitro translation systems: Use cell-free translation systems with ER microsomes from wild-type and SSR3-deficient cells

    • Reporter protein selection: Use a panel of proteins with varying glycosylation requirements

      • Type I membrane proteins (single transmembrane domain)

      • Multiple transmembrane domain proteins

      • Soluble secretory proteins

    • Readout: Protease protection assays to determine successful translocation independent of glycosylation state

  • Site-directed mutagenesis approach:

    • Create SSR3 mutants that specifically disrupt interaction with:

      • Translocation machinery components

      • OST complex components

    • Test these mutants for differential rescue of translocation versus glycosylation defects

  • Temporal separation experiments:

    • Use pulse-chase experiments with radioactive amino acids to track protein translation and translocation

    • Follow with glycosylation analysis at different time points

    • This approach can reveal if translocation defects precede glycosylation issues

  • Conditional interaction disruption:

    • Use small molecule inhibitors specific to translocation (e.g., cotransin) versus glycosylation (e.g., tunicamycin)

    • Compare phenotypes to those observed with SSR3 deficiency

    • Look for synergistic or redundant effects

  • Structural biology approaches:

    • Cryo-EM studies of the TRAP complex with and without associated translocation machinery or OST

    • Crosslinking mass spectrometry to map interaction surfaces involved in each process

These methodological approaches collectively provide a comprehensive strategy to dissect the distinct contributions of SSR3 to protein translocation versus glycosylation processes.

What statistical approaches are most appropriate for analyzing SSR3 expression data across different experimental conditions?

When analyzing SSR3 expression data across various experimental conditions, researchers should consider the following statistical approaches:

  • For comparing two groups:

    • Student's t-test: For normally distributed data with equal variances

    • Welch's t-test: For normally distributed data with unequal variances

    • Mann-Whitney U test: For non-normally distributed data

  • For multiple group comparisons:

    • One-way ANOVA with post-hoc tests: For normally distributed data comparing three or more conditions

      • Tukey's HSD for all pairwise comparisons

      • Dunnett's test when comparing multiple treatments to a single control

    • Kruskal-Wallis with post-hoc Dunn's test: For non-parametric analysis of multiple groups

  • For time course experiments:

    • Two-way ANOVA: For analyzing effects of treatment and time

    • Repeated measures ANOVA: When measuring the same samples across multiple timepoints

    • Mixed-effects models: To account for random and fixed effects in complex experimental designs

  • For clinical correlations:

    • Cox proportional hazards regression: For analyzing the relationship between SSR3 expression and patient survival or treatment response

    • Logistic regression: For binary outcomes such as response/non-response to treatment

  • Data normalization considerations:

    • Normalize gene expression to multiple stable reference genes (e.g., GAPDH, ACTB, 18S rRNA)

    • Consider using geometric means of multiple housekeeping genes for more stable normalization

    • For protein expression, total protein normalization methods may be more reliable than single housekeeping proteins

  • Sample size determination:

    • Conduct power analysis based on expected effect sizes from preliminary data

    • For exploratory studies, ensure at least 3-5 biological replicates per condition

    • For validation studies, increase to at least 5-10 biological replicates

All statistical analyses should be accompanied by appropriate visualization (box plots, bar graphs with individual data points) and reporting of exact p-values, confidence intervals, and effect sizes .

How should researchers interpret changes in SSR3 protein levels in the context of TRAP complex stability?

Interpreting changes in SSR3 protein levels requires careful consideration of its role within the TRAP complex and broader cellular context:

  • Primary vs. secondary effects analysis:

    • Transcriptional regulation: Assess whether changes in SSR3 protein levels correspond to mRNA level changes using qRT-PCR

    • Protein stability: Determine protein half-life using cycloheximide chase experiments in control vs. experimental conditions

    • Complex-dependent stability: Compare degradation rates of SSR3 alone versus other TRAP complex components (SSR1, SSR2, SSR4)

  • Quantitative relationship assessment:

    • Dose-response relationship: Establish whether partial reductions in SSR3 cause proportional or threshold effects on complex stability

    • Stoichiometry analysis: Determine if SSR3:other subunit ratios remain constant across conditions

    • Compensatory mechanisms: Look for upregulation of other components that might maintain complex function

  • Functional consequence interpretation:

    • Glycosylation reporter assays: Correlate SSR3 levels with glycosylation efficiency of reporter proteins (GP130, ICAM1)

    • ER stress indicators: Measure UPR activation markers (BiP, XBP1 splicing) to assess downstream effects

    • Cellular phenotypes: Correlate SSR3/TRAP complex levels with relevant cellular outcomes

  • Context-dependent interpretation framework:

    • Cell type specificity: Compare effects across different cell types with varying basal SSR3 expression

    • Stress conditions: Evaluate effects under normal conditions versus ER stress (e.g., tunicamycin treatment)

    • Developmental context: Consider temporal aspects of expression during differentiation or development

This comprehensive interpretative framework ensures that changes in SSR3 protein levels are properly contextualized within the complex regulatory network of the TRAP complex and cellular homeostasis.

What approaches can be used to resolve contradictory findings regarding SSR3 function in different experimental systems?

Resolving contradictory findings regarding SSR3 function across different experimental systems requires a systematic investigative approach:

  • Systematic meta-analysis of methodology:

    • Create a comprehensive table comparing key methodological variables across studies:

      • Cell/tissue types and species (human vs. bovine)

      • Expression levels (endogenous vs. overexpression)

      • Analytical techniques and their sensitivities

      • Environmental conditions (stress factors, growth conditions)

    • Identify patterns that might explain divergent results

  • Sequential validation protocol:

    • Design experiments that bridge methodological gaps between contradictory studies

    • Reproduce key experiments using standardized protocols across multiple systems

    • Implement blinded analysis to minimize experimenter bias

  • Conditional functionality analysis:

    • Test the hypothesis that SSR3 may have context-dependent functions

    • Systematically vary conditions (cell cycle stage, stress levels, growth factors)

    • Look for interaction effects that might explain apparently contradictory results

  • Mixed methods data integration:

    • Combine quantitative (expression levels, activity measurements) and qualitative (localization, interaction partners) data

    • Develop an integrated model that accounts for seemingly contradictory observations

    • Use computational modeling to test whether contradictions can be resolved through systems-level effects

  • Collaborative resolution approach:

    • Initiate collaborative experiments between groups with contradictory findings

    • Exchange key reagents (antibodies, cell lines, expression constructs)

    • Perform side-by-side experiments with personnel from both groups

ApproachAdvantagesLimitationsBest Used When
Meta-analysisIdentifies patterns across studiesLimited by published data qualityMultiple published studies exist
Sequential validationDirectly tests hypothesesResource intensiveKey contradictions need resolution
Conditional analysisDiscovers context-dependent effectsComplex experimental designSimple contradictions are ruled out
Mixed methodsIntegrates diverse data typesRequires specialized analytical skillsContradictions span methodology types
CollaborativeEliminates lab-specific variablesRequires cooperationHigh-stakes contradictions exist

This structured approach transforms apparent contradictions into opportunities for deeper understanding of the context-dependent functions and regulation of SSR3 .

What emerging technologies show promise for advancing our understanding of SSR3 function?

Several cutting-edge technologies are poised to revolutionize our understanding of SSR3 function in the coming years:

  • Cryo-electron microscopy:

    • High-resolution structural determination of the entire TRAP complex

    • Visualization of conformational changes during protein translocation

    • Mapping of interaction interfaces between SSR3 and other components of the translocation machinery

  • Proximity-dependent labeling technologies:

    • BioID, TurboID, or APEX2 fusions with SSR3 to identify transient interaction partners

    • Spatial and temporal mapping of SSR3 interactome changes under various conditions

    • Identification of cell-type specific interaction networks

  • Single-molecule imaging techniques:

    • Super-resolution microscopy (PALM/STORM) to visualize SSR3 distribution and dynamics

    • Single-molecule FRET to monitor conformational changes during activity

    • Tracking of individual translocation events in real-time

  • CRISPR-based technologies:

    • CRISPR activation/inhibition (CRISPRa/CRISPRi) for precise modulation of SSR3 expression

    • Base editing or prime editing for introducing specific mutations

    • CRISPR screens with single-cell readouts to identify genetic interactions

  • Organoid and advanced cell culture models:

    • Patient-derived organoids to study tissue-specific effects of SSR3 mutations

    • Brain organoids to investigate neurodevelopmental aspects of SSR3-related CDG

    • Microfluidic organ-on-chip systems to study tissue interactions

  • Computational approaches:

    • Machine learning to predict functional impacts of SSR3 variants

    • Molecular dynamics simulations of SSR3 within the TRAP complex

    • Network analysis to position SSR3 within broader cellular pathways

These technologies will collectively enable researchers to move beyond correlative observations to mechanistic understanding of SSR3 function across multiple biological contexts.

How can systems biology approaches be applied to understand SSR3's role in broader cellular networks?

Systems biology approaches offer powerful frameworks for contextualizing SSR3 within broader cellular networks:

  • Multi-omics integration strategies:

    • Combine transcriptomics, proteomics, glycomics, and metabolomics data

    • Analyze temporal dynamics following SSR3 perturbation

    • Identify emergent patterns not visible in single-omics analyses

    • Methods include WGCNA (weighted gene co-expression network analysis), DIABLO (multi-omics integration), and similarity network fusion

  • Network inference and analysis:

    • Construct protein-protein interaction networks centered on SSR3

    • Identify network motifs and modules that include SSR3

    • Calculate network centrality measures to quantify SSR3's importance

    • Use algorithms like ARACNE, CLR, or Bayesian networks for inferring regulatory relationships

  • Pathway enrichment and perturbation analysis:

    • Identify pathways significantly affected by SSR3 perturbation

    • Quantify pathway activity using methods like GSEA, GSVA, or PROGENy

    • Model pathway crosstalk to understand compensatory mechanisms

    • Predict cellular phenotypes from pathway activities

  • Constraint-based modeling:

    • Integrate SSR3 into genome-scale metabolic models

    • Predict metabolic flux changes resulting from SSR3 perturbation

    • Use flux balance analysis to identify critical metabolic dependencies

    • Model the glycosylation pathway with and without functional SSR3

  • Single-cell multi-omics approaches:

    • Analyze cell-to-cell variability in SSR3 expression and function

    • Identify cell states particularly dependent on SSR3

    • Map trajectories of cellular responses to SSR3 perturbation

    • Integrate with spatial transcriptomics to understand tissue context

These systems biology approaches transform reductionist knowledge about SSR3 into comprehensive understanding of its position within cellular networks, revealing emergent properties and unexpected functional relationships that could not be discovered through traditional approaches.

What are the key considerations for designing a comprehensive research program focused on recombinant bovine SSR3?

A comprehensive research program investigating recombinant bovine SSR3 should incorporate multiple complementary approaches spanning from molecular mechanisms to physiological significance. Key considerations include:

  • Foundational characterization:

    • Establish expression patterns across bovine tissues and developmental stages

    • Determine protein structure and membrane topology

    • Characterize post-translational modifications specific to bovine SSR3

    • Compare and contrast with human SSR3 to identify conserved and divergent features

  • Functional investigations:

    • Develop robust assays for measuring both translocation and glycosylation functions

    • Create a panel of mutants to map structure-function relationships

    • Identify substrate specificity determinants

    • Explore regulatory mechanisms controlling SSR3 activity

  • Integration with cellular pathways:

    • Map the complete interactome of bovine SSR3

    • Characterize how SSR3 responds to various cellular stresses

    • Determine cell-type specific functions and requirements

    • Position SSR3 within broader ER quality control networks

  • Translational applications:

    • Evaluate potential as a biomarker for specific conditions

    • Explore therapeutic targeting strategies

    • Investigate role in bovine diseases and development

    • Establish relevance to comparative medicine

  • Technical resource development:

    • Generate validated antibodies and expression constructs

    • Establish reporter systems for functional assays

    • Create cellular and animal models with modified SSR3

    • Develop computational tools for predicting variant effects

This multifaceted approach ensures comprehensive understanding of bovine SSR3 from molecular mechanisms to physiological significance, while building valuable resources for the broader research community.

What are the most promising directions for translational research involving SSR3?

Based on current evidence, several promising translational research directions for SSR3 warrant further investigation:

  • Biomarker development for cancer therapeutics:

    • Validate SSR3 as a predictive biomarker for paclitaxel response in diverse cancer types

    • Develop standardized assays for measuring SSR3 in clinical samples

    • Conduct prospective clinical studies to determine predictive value

    • Investigate potential for patient stratification in clinical trials

  • Therapeutic strategies for CDG caused by SSR3 mutations:

    • Screen for small molecules that stabilize mutant SSR3 or the TRAP complex

    • Explore gene therapy approaches for SSR3 replacement

    • Investigate downstream interventions to mitigate glycosylation defects

    • Develop patient-derived models for personalized therapy testing

  • SSR3 in stress response and neurodegenerative diseases:

    • Explore connections between SSR3/TRAP function and ER stress in neurodegeneration

    • Investigate potential protective roles of SSR3 modulation in models of protein misfolding diseases

    • Determine if SSR3 function changes during aging or in age-related diseases

    • Develop strategies to enhance SSR3-dependent quality control mechanisms

  • Glycosylation engineering applications:

    • Utilize SSR3 modifications to alter glycosylation patterns of recombinant proteins

    • Develop cell lines with engineered SSR3 for biopharmaceutical production

    • Explore applications in modifying immunogenicity of therapeutic proteins

    • Investigate species-specific differences for cross-species protein production

  • Comparative medicine opportunities:

    • Leverage bovine-human comparisons for evolutionary insights into ER function

    • Investigate species-specific responses to ER stress and protein quality control

    • Explore implications for zoonotic disease susceptibility and transmission

    • Develop comparative models for studying conserved secretory pathway functions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.