Recombinant Bovine Transmembrane 4 L6 family member 20 (TM4SF20)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Bovine Transmembrane 4 L6 Family Member 20 (TM4SF20) is a synthetically produced protein belonging to the L6 tetraspanin superfamily. This four-transmembrane protein is involved in critical cellular processes such as adhesion, proliferation, and signal transduction . Its recombinant form enables precise study of its structural and functional roles in bovine physiology and disease models, particularly in cancer and metabolic research .

Recombinant Production

The bovine TM4SF20 protein is engineered for high-purity research applications:

ParameterDetails
Expression SystemEscherichia coli (E. coli)
TagN-terminal His-tag
Purity>90% (verified by SDS-PAGE)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionSterile water; glycerol (5–50%) recommended for long-term storage
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles

Source: Creative BioMart product specifications .

Biochemical Properties

  • Molecular Weight: ~26 kDa (calculated for unmodified protein; glycosylation may increase observed mass) .

  • Stability: Maintains integrity under lyophilization but degrades upon repeated thawing.

  • Solubility: Requires reconstitution in aqueous buffers; aggregates may form at high concentrations.

Functional Insights

TM4SF20 regulates cellular processes through:

  • Topological Plasticity: Ceramide induces structural rearrangement ("regulated alternative translocation"), enabling interaction with CREB3L1 to inhibit collagen synthesis .

  • Cancer Relevance: In humans, TM4SF20 overexpression in cancers (e.g., lung adenocarcinoma) correlates with antibody-dependent cytotoxicity . Bovine homologs may share similar pathways.

  • Neurological Role: Truncated TM4SF20 variants mislocalize to the cytoplasm, potentially disrupting membrane signaling .

Table 1: Key Applications of Recombinant Bovine TM4SF20

FieldApplication
Cancer BiologyStudy antibody-dependent cellular cytotoxicity (ADCC) mechanisms .
NeurobiologyInvestigate cytoplasmic mislocalization effects in neuronal cells .
Metabolic StudiesExplore lipid metabolism links (e.g., ceramide signaling) .
Structural BiologyMap transmembrane topology and glycosylation patterns .

Comparative Insights

  • Topological Conservation: Retrotranslocation mechanisms observed in human A549 cells likely apply to bovine variants.

  • Therapeutic Potential: Anti-TM4SF20 antibodies tested in human cancers could inform bovine immunotherapies.

Future Directions

  • Mechanistic Studies: Clarify bovine TM4SF20’s role in lipid metabolism and ceramide signaling .

  • Agricultural Relevance: Assess impacts on bovine health, including metabolic stress in dairy cows .

  • Biotechnological Use: Optimize recombinant production for high-throughput antibody generation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. This can serve as a reference point.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
TM4SF20; Transmembrane 4 L6 family member 20
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TM4SF20
Target Protein Sequence
MTCCEGWTSCNGFSLLVLLLLGVTLNAIPLILNFVDEDQFFENPISCFEWWFPGIIGAGV MAIPATTMSLAARKRACCNNKTGMFLSSLLNAITVIGAAYCLLVSIQALAEGPLICNSQS NTTSSCEFSLKNLTANYKESFDLQWFFEDSCVPHTDSNNPSITNTTANNWRVYNLHFNSI ENQHRIIHFSVFLGLLLVGILEILFGLSQIIIGFFGCLCGGVSNGRSQIV
Uniprot No.

Target Background

Function
TM4SF20 is a polytopic transmembrane protein. It inhibits regulated intramembrane proteolysis (RIP) of CREB3L1, thereby inhibiting its activation and the induction of collagen synthesis. In response to ceramide, which alters TM4SF20 membrane topology, it stimulates RIP activation of CREB3L1. Ceramide reverses the direction of transmembrane helix translocation into the endoplasmic reticulum membrane during TM4SF20 translation. This mechanism, termed 'regulated alternative translocation' (RAT), regulates the function of the transmembrane protein.
Database Links

KEGG: bta:767902

UniGene: Bt.21850

Protein Families
L6 tetraspanin family
Subcellular Location
Membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is TM4SF20 and which protein family does it belong to?

TM4SF20 belongs to the L6 tetraspanin family, a branch of the tetraspanin superfamily. Members of this family are characterized by their transmembrane structure and are frequently overexpressed in tumor cells from various cancer types, although direct evidence of their oncogenic activity has not been consistently demonstrated . The protein contains characteristic L6 membrane domains and multiple transmembrane domains. These structural features allow TM4SF20 to span cellular membranes multiple times, creating distinct topological conformations that are critical to its biological functions .

The protein is expressed at relatively low levels compared to average gene expression (approximately 16.6% of average gene expression in some databases) . This low expression pattern may contribute to the challenges in studying this protein and could be physiologically significant, suggesting tight regulation of its abundance under normal conditions.

What is the gene structure and expression pattern of TM4SF20?

The TM4SF20 gene contains four different GT-AG introns, with transcription producing a single mRNA species. The gene includes three validated alternative polyadenylation sites, suggesting potential for post-transcriptional regulation . The spliced mRNA encodes a functional protein containing the L6 membrane domain and multiple transmembrane domains.

TM4SF20 proteins are expected to localize in various cellular compartments, with their precise localization depending on their topological state. In terms of tissue distribution, TM4SF20 shows notable expression in mouse intestine, which also expresses high levels of CREB3L1, suggesting a potential functional relationship between these proteins in intestinal tissue . The relatively restricted expression pattern may indicate tissue-specific functions of TM4SF20.

What are the different topological forms of TM4SF20?

TM4SF20 exists in three distinct topological forms, each with different localization and functional properties:

  • TM4SF20(A): An N-terminally truncated, non-glycosylated protein with its C-terminus located in the lumen. This form is prevalent in cells under basal conditions and represents a proteolytic product of TM4SF20(C) .

  • TM4SF20(B): The full-length glycosylated protein with its C-terminus located in the cytosol. This form appears following ceramide treatment and is capable of stimulating proteolytic activation of CREB3L1, thereby activating genes that inhibit cell proliferation .

  • TM4SF20(C): A glycosylated full-length protein that is difficult to detect by immunoblot analysis without deglycosylation. It serves as the precursor for TM4SF20(A) through proteolytic processing .

The topological arrangement of these forms is critically important for the protein's function, as shown in the following table:

FormGlycosylation StatusC-terminus LocationN-terminus StatusFunction
TM4SF20(A)Non-glycosylatedLumenTruncatedUnclear, dominant form under basal conditions
TM4SF20(B)GlycosylatedCytosolFull-lengthActivates CREB3L1, inhibits cell proliferation
TM4SF20(C)Glycosylated (endo H-resistant)VariableFull-lengthPrecursor for TM4SF20(A)

How can TM4SF20 be detected in research samples?

Several methods are available for detecting TM4SF20 in research samples:

ELISA-based detection: Bovine TM4SF20 ELISA kits employ a two-site sandwich ELISA method. These kits use an antibody specific for TM4SF20 pre-coated onto a microplate. After sample addition, any TM4SF20 present binds to the immobilized antibody. Following washing steps, a biotin-conjugated antibody specific for TM4SF20 is added, followed by Streptavidin-HRP. After additional washing, a substrate solution develops color proportional to the amount of TM4SF20 bound .

Immunoblot analysis: Different forms of TM4SF20 can be distinguished by immunoblotting, though TM4SF20(C) may be difficult to detect without deglycosylation due to its glycosylation status. For comprehensive analysis, samples can be treated with glycosidases such as endoglycosidase H (endo H) or peptide N-glycosidase F (PNGase F) to assess glycosylation patterns .

Epitope tagging strategies: For detailed analysis of protein topology, researchers can employ epitope tagging (e.g., Myc or FLAG tags) at either N- or C-termini of the protein. This approach has proven useful for identifying different topological forms and tracking proteolytic processing .

What is Regulated Alternative Translocation (RAT) of TM4SF20?

Regulated Alternative Translocation (RAT) refers to the ceramide-induced topological alteration of TM4SF20. This process involves complex changes in protein topology that significantly affect its function and cellular effects . RAT represents a novel mechanism for regulating membrane protein function through dynamic changes in topology rather than through conventional mechanisms like phosphorylation or ubiquitination.

The process involves several key steps:

  • TM4SF20 is initially synthesized with N132, N148, and N163 in loop 3 glycosylated in the lumen.

  • After synthesis, part of loop 3 undergoes retrotranslocation from the lumen to the cytosol.

  • This retrotranslocation exposes the sequence surrounding glycosylated N163 to the cytosol.

  • Simultaneously, the C-terminus relocates from the cytosol to the lumen.

  • In the absence of ceramide, TM4SF20 is transported from the ER to post-Golgi compartments, where it exists as the retrotranslocated protein (TM4SF20(C)).

  • Proteolysis of TM4SF20(C) at the retrotranslocated region produces TM4SF20(A) .

Ceramide treatment disrupts this process by delaying the conversion from partially retrotranslocated TM4SF20(B) to fully retrotranslocated TM4SF20(C), leading to accumulation of TM4SF20(B), which can then activate CREB3L1 and inhibit cell proliferation .

What structural motifs are critical for TM4SF20 function?

A GXXXN motif present in the first transmembrane helix of TM4SF20 is critical for the Regulated Alternative Translocation (RAT) of the protein. Mutations disrupting this motif lock the protein into the TM4SF20(B) form regardless of ceramide treatment . This finding suggests that this motif serves as a conformational switch that regulates the protein's topological states.

The cleavage site that generates TM4SF20(A) from TM4SF20(C) has been mapped between G156 and F177, providing crucial information about the proteolytic processing of the protein . This region likely contains recognition sequences for proteases involved in TM4SF20 processing.

The protein also contains multiple N-glycosylation sites (N132, N148, and N163) that are important for tracking the protein's topology and may play functional roles in protein folding and stability . The glycosylation status of these sites serves as a useful marker for distinguishing between different topological forms of the protein.

How does ceramide influence TM4SF20 topology and function?

Ceramide plays a crucial role in regulating TM4SF20 topology and function through several mechanisms:

  • Under ceramide treatment (such as with doxorubicin, which enhances de novo ceramide synthesis and sphingomyelinase activities), TM4SF20 predominantly exists as the full-length glycosylated protein TM4SF20(B) .

  • Ceramide inhibits the retrotranslocation step that would normally convert TM4SF20(B) to TM4SF20(C), leading to accumulation of TM4SF20(B) .

  • The accumulated TM4SF20(B) can stimulate proteolytic activation of CREB3L1, allowing this transcription factor to activate genes that inhibit cell proliferation .

  • This ceramide-induced topological alteration is critical for doxorubicin to inhibit cancer cell proliferation, suggesting that TM4SF20 may serve as a mediator of ceramide's anti-proliferative effects in cancer therapy .

The relationship between ceramide levels and TM4SF20 topology provides a mechanistic link between lipid signaling and protein function that may be relevant to understanding cancer cell responses to chemotherapeutic agents.

What is the relationship between TM4SF20 and CREB3L1?

TM4SF20(B), the form that accumulates after ceramide treatment, stimulates proteolytic activation of CREB3L1, a transcription factor that activates genes involved in inhibiting cell proliferation . This relationship establishes TM4SF20 as an upstream regulator of CREB3L1-mediated growth suppression pathways.

The co-expression of TM4SF20 and CREB3L1 in mouse intestine further suggests a physiologically relevant functional relationship between these proteins . This co-expression pattern may indicate that TM4SF20-mediated regulation of CREB3L1 plays important roles in normal intestinal physiology as well as in pathological conditions.

The TM4SF20-CREB3L1 axis appears to be a critical mediator of doxorubicin's anti-proliferative effects on cancer cells, establishing this pathway as a potential target for cancer therapy . Understanding the molecular details of this interaction could provide insights for developing novel cancer treatments that target this pathway.

What methods are available for studying TM4SF20 expression and activation?

Several methodological approaches can be employed for studying TM4SF20:

Lentiviral Activation System: TM4SF20 Lentiviral Activation Particles utilize a synergistic activation mediator (SAM) transcription activation system to upregulate endogenous TM4SF20 expression. This system employs a deactivated Cas9 (dCas9) nuclease fused to a VP64 activation domain, along with sgRNA engineered to bind an MS2-P65-HSF1 fusion protein . This approach allows for targeted upregulation of TM4SF20 expression without altering the gene sequence itself.

CRISPR-Cas9 Genomic Editing: For studies requiring modification of the endogenous TM4SF20 gene, CRISPR-Cas9 technology can be used to insert epitope tags or introduce specific mutations. This approach has been successfully used to insert a Myc tag at the C-terminus of the mouse Tm4sf20 gene .

Protease Protection Assays: These assays can determine the topology of TM4SF20 by assessing which regions of the protein are accessible to proteases. This method has been used to distinguish between TM4SF20(A) and TM4SF20(B) based on the location of their C-termini .

Deglycosylation Analysis: Treatment with glycosidases like endoglycosidase H (endo H) or peptide N-glycosidase F (PNGase F) can provide information about the glycosylation status and trafficking of TM4SF20 through the secretory pathway .

How can researchers manipulate TM4SF20 topology in experimental settings?

Researchers can manipulate TM4SF20 topology through several approaches:

Ceramide Treatment: Adding exogenous ceramide or ceramide analogs (such as C6-ceramide) can induce the accumulation of TM4SF20(B) . This approach provides a straightforward method for studying the functional consequences of altered TM4SF20 topology.

Mutations in the GXXXN Motif: Introducing mutations that disrupt the GXXXN motif in the first transmembrane helix can lock TM4SF20 into the TM4SF20(B) form regardless of ceramide treatment . This genetic approach allows for constitutive expression of a specific topological form.

Cys Scanning Approach: This methodological approach, which involves systematic replacement of residues with cysteine, can be used to map the topology of TM4SF20 and identify critical regions for topological changes . This technique has been used to narrow down the cleavage site that generates TM4SF20(A).

What cell and animal models are suitable for TM4SF20 research?

Based on the available information, several experimental models appear suitable for TM4SF20 research:

Cell Models:

  • A549 cells: Human lung adenocarcinoma cells that have been used for stable transfection of TM4SF20 .

  • SV589 cells: Transformed fibroblasts that provide high transfection efficiency and facilitate detection of TM4SF20(C) .

Animal Models:

  • Mouse models with genomic editing of Tm4sf20: Mice with C-terminal Myc tagging of endogenous Tm4sf20 have been generated using CRISPR-Cas9 technology, allowing for detection of endogenous protein forms .

  • Mouse intestine: This tissue expresses high levels of both Tm4sf20 and Creb3l1, suggesting it may be an appropriate physiological system for studying their interaction .

When selecting a model system, researchers should consider factors such as endogenous expression levels, ease of genetic manipulation, and relevance to the biological question being addressed. The choice between cell and animal models should be guided by the specific research objectives and the need for physiological context.

What are effective strategies for investigating TM4SF20's role in cancer?

Given the overexpression of L6 family members in various cancer types and the involvement of TM4SF20 in regulating cell proliferation pathways , several strategies may be effective for investigating its role in cancer:

Correlation Studies: Analyze TM4SF20 expression levels across cancer types and stages to identify potential associations with disease progression or patient outcomes. This approach can provide initial evidence for a role in specific cancer types.

Functional Genomics: Use CRISPR-Cas9 knockout or lentiviral activation of TM4SF20 in cancer cell lines to assess effects on proliferation, apoptosis, migration, and other cancer-related phenotypes . This approach can establish causality between TM4SF20 expression and cancer-related cellular behaviors.

Ceramide Pathway Modulation: Since ceramide regulates TM4SF20 topology and function, investigating the interplay between ceramide metabolism and TM4SF20 in cancer cells may reveal novel therapeutic opportunities . This strategy links TM4SF20 research to the well-established field of lipid signaling in cancer.

CREB3L1 Activation Analysis: As TM4SF20(B) stimulates CREB3L1 activation, measuring CREB3L1 target gene expression in response to TM4SF20 manipulation can provide insights into the downstream effects relevant to cancer . This approach focuses on the functional consequences of altered TM4SF20 activity.

How can researchers distinguish between different forms of TM4SF20 in experimental samples?

Distinguishing between the three forms of TM4SF20 requires a combination of approaches:

Molecular Weight Analysis: TM4SF20(A), TM4SF20(B), and TM4SF20(C) have different apparent molecular weights on SDS-PAGE, with TM4SF20(C) being approximately 55 kDa, TM4SF20(B) being glycosylated but smaller than TM4SF20(C), and TM4SF20(A) being unglycosylated and N-terminally truncated .

Glycosidase Treatment: Treatment with endoglycosidase H (endo H) or peptide N-glycosidase F (PNGase F) can help distinguish between glycosylated and non-glycosylated forms. TM4SF20(B) is sensitive to both enzymes, TM4SF20(C) is resistant to endo H but sensitive to PNGase F, and TM4SF20(A) is unglycosylated and thus unaffected by either enzyme .

Epitope Detection: Using differently tagged versions of TM4SF20 (e.g., N-terminal FLAG tag and C-terminal Myc tag) can help determine which regions are present in each form. TM4SF20(A) can only be detected by C-terminal but not N-terminal epitope tags, indicating its N-terminal truncation .

Protease Protection Assays: These assays can determine the topology of each form by assessing the accessibility of different regions to proteases, helping to distinguish between forms with different topological arrangements .

What are common challenges in TM4SF20 detection and analysis?

Researchers may encounter several challenges when working with TM4SF20:

Low Endogenous Expression: TM4SF20 is expressed at relatively low levels (approximately 16.6% of the average gene expression) , making detection of endogenous protein challenging without sensitive methods or overexpression systems.

Difficulty Detecting TM4SF20(C): TM4SF20(C) is often difficult to detect by immunoblot analysis without deglycosylation due to its extensive glycosylation, which can lead to underestimation of its abundance . This issue necessitates careful sample preparation and appropriate controls.

Complex Topology Changes: The dynamic changes in TM4SF20 topology in response to ceramide and other stimuli can complicate interpretation of experimental results, particularly if the experimental conditions affect these transitions . Time-course experiments and careful control of cellular conditions are important for addressing this challenge.

Proteolytic Processing: The proteolytic conversion of TM4SF20(C) to TM4SF20(A) adds another layer of complexity to the analysis, requiring methods that can track this processing event . Protease inhibitors or pulse-chase experiments may be needed to fully characterize this aspect of TM4SF20 biology.

How should contradictory data on TM4SF20 function be interpreted?

When encountering contradictory data on TM4SF20 function, researchers should consider several factors:

Cell Type-Specific Effects: Different cell types may express different levels of proteins involved in TM4SF20 processing or downstream signaling, leading to apparently contradictory results across systems . Systematic comparison across multiple cell types can help resolve such contradictions.

Topological Form Specificity: Given that different topological forms of TM4SF20 have distinct functions, contradictory data may result from differences in the predominant form present under the experimental conditions used . Careful characterization of which form(s) are present in each experimental system is essential.

Ceramide Levels and Composition: Since ceramide regulates TM4SF20 topology, variations in cellular ceramide levels or composition between experimental systems could contribute to contradictory results . Standardizing or monitoring ceramide status can help address this issue.

What controls are essential for TM4SF20 research experiments?

Several critical controls should be included in TM4SF20 research:

Glycosidase Controls: When analyzing glycosylation status, samples should be treated with both endo H and PNGase F to distinguish between different types of glycosylation and help identify specific topological forms .

Epitope Tag Controls: When using epitope-tagged constructs, controls with tags at different positions (N-terminal, C-terminal, or internal) can help interpret results and avoid misattribution of signals .

Ceramide Treatment Controls: For experiments involving ceramide, appropriate vehicle controls and concentration gradients should be included to ensure specificity of effects. Additionally, ceramide analogs with different chain lengths or modifications can help determine structure-activity relationships .

Specificity Controls for Antibodies: Given the multiple forms of TM4SF20 and potential for cross-reactivity, antibody specificity should be validated using overexpression systems, knockout controls, or competitive binding assays .

Cellular Compartment Controls: When assessing TM4SF20 localization or topology, markers for different cellular compartments (ER, Golgi, plasma membrane) should be included to provide context for the observations .

What are the unexplored aspects of TM4SF20 biology?

Despite significant progress in understanding TM4SF20, several aspects remain unexplored:

Physiological Regulators of RAT: While ceramide has been identified as a regulator of TM4SF20 topology, other physiological molecules or conditions that might influence this process remain to be discovered . Identifying these factors could provide insights into the biological contexts in which TM4SF20 topology is regulated.

Tissue-Specific Functions: Given its expression in mouse intestine and other tissues, the physiological functions of TM4SF20 in normal tissue homeostasis and development warrant further investigation . Tissue-specific knockout models could help elucidate these functions.

Interaction Partners: The proteins that interact with different forms of TM4SF20 and mediate its downstream effects, particularly the activation of CREB3L1, remain largely unknown . Proteomics approaches could help identify these partners and clarify the molecular mechanisms involved.

Evolutionary Conservation: The conservation of TM4SF20 function and topology regulation across species has not been extensively studied . Comparative studies could reveal evolutionary constraints and innovations in this regulatory mechanism.

How might TM4SF20 research inform therapeutic approaches?

TM4SF20 research has several potential therapeutic implications:

Cancer Therapy Sensitization: Given TM4SF20's role in mediating doxorubicin's anti-proliferative effects, manipulating its topology or expression might sensitize cancer cells to chemotherapy . This approach could potentially enhance treatment efficacy or overcome resistance.

Targeted Activation of CREB3L1: Since TM4SF20(B) activates CREB3L1 to inhibit cell proliferation, developing compounds that specifically promote this topological form might offer a novel strategy for cancer treatment . Such compounds would work by enhancing an endogenous anti-proliferative pathway.

Biomarkers for Treatment Response: The topological state of TM4SF20 might serve as a biomarker for predicting cancer cell responses to ceramide-inducing therapies like doxorubicin . This application could help personalize treatment approaches based on tumor characteristics.

Lipid-Based Therapy Optimization: Understanding how ceramide regulates TM4SF20 topology could inform the development of more effective lipid-based cancer therapies that target this pathway . This approach would build upon existing knowledge of ceramide's anti-cancer properties.

What novel technologies could advance TM4SF20 research?

Several emerging technologies could significantly advance TM4SF20 research:

Single-Cell Analysis: Single-cell transcriptomics and proteomics could reveal cell-to-cell variations in TM4SF20 expression and topological states that may be masked in bulk analyses . This approach could provide insights into heterogeneity within tissues or cell populations.

Live-Cell Topology Sensors: Development of fluorescent reporters that can distinguish between different topological forms of TM4SF20 in living cells would enable real-time monitoring of topology changes . Such tools would facilitate studies of dynamics and regulatory mechanisms.

Cryo-EM Structural Analysis: High-resolution structural studies of TM4SF20 in different topological states could provide mechanistic insights into how ceramide and other factors regulate its topology . Structural information would also aid in the rational design of compounds targeting specific forms of the protein.

Organ-on-Chip Models: These advanced culture systems could provide more physiologically relevant contexts for studying TM4SF20 function in specific tissues, potentially revealing roles that are not apparent in standard cell culture . Such models would bridge the gap between in vitro and in vivo studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.