Recombinant Bovine Transmembrane and coiled-coil domain-containing protein 2 (TMCO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TMCO2; Transmembrane and coiled-coil domain-containing protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TMCO2
Target Protein Sequence
MSSSSSIWDIIIDYLSLSSIWNYLQATLLGETSVPQQTNLGPLDNLAPAVQVILGISFLI LLGVGMYALWKRSVQSIQKILLFAITLYKLYKKGSDFFQALLVNPEGSDLTLQDNNIFLS LGLQEKILKKLQTVENKVKDLEGMIISQKPTTKREYSSDHYCSCSDCQSPLPTSGFTSTS EM
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Bovine TMCO2 and what are its primary structural characteristics?

Recombinant Bovine Transmembrane and coiled-coil domain-containing protein 2 (TMCO2) is a protein characterized by its transmembrane regions and coiled-coil structural motifs. As with other transmembrane proteins, it contains hydrophobic domains that anchor it within cellular membranes, while the coiled-coil domains typically facilitate protein-protein interactions. Research approaches for structural characterization would include techniques similar to those used for other bovine proteins, employing statistical methods for data analysis comparable to those described in colon cancer biomarker studies .

What expression systems are most effective for producing Recombinant Bovine TMCO2?

The selection of an appropriate expression system depends on research objectives and downstream applications. For functional studies requiring proper protein folding and post-translational modifications, mammalian cell lines may be preferred. For structural studies requiring higher yields, bacterial or yeast expression systems might be more suitable. Methodological considerations should include codon optimization for the selected expression system, purification tag selection, and verification of protein integrity through methods such as mass spectrometry.

How should sample preparation be optimized for TMCO2 detection assays?

Sample preparation for TMCO2 detection should follow protocols similar to those developed for other bovine proteins. Based on methodologies used for biomarker detection in bovine samples, a generic sample pre-treatment followed by immunoassay development would be appropriate. For example, the flow cytometric immunoassay (FCIA) approach used for bovine somatotropin biomarkers could be adapted for TMCO2 . This would include optimization of sample dilution, buffer composition, and antibody selection for specific and sensitive detection.

What are the recommended statistical approaches for analyzing TMCO2 expression data?

Statistical analysis of TMCO2 expression data should employ robust methodologies similar to those used in other protein studies. Based on the statistical methods described in the search results, recommended approaches include:

  • Using SPSS software (version 19.0 or higher) and GraphPad Prism for data analysis and visualization

  • Expressing data as mean ± standard deviation

  • Employing independent-samples t-tests for comparing two groups

  • Using one-way ANOVA and LSD t-tests for multiple group comparisons

  • Setting significance threshold at p<0.05

For survival analysis and correlation with clinical factors, Kaplan-Meier analysis and multivariate analysis using Cox proportional hazards models would be appropriate, similar to methods employed in biomarker evaluation studies .

How can multiplex immunoassays be developed for simultaneous detection of TMCO2 and related biomarkers?

Development of multiplex immunoassays for TMCO2 should follow protocols similar to those used for other bovine protein biomarkers. Based on the methodologies described for rbST detection, researchers could develop a multiplex flow cytometric immunoassay (FCIA) that includes TMCO2 and related proteins of interest . This approach would include:

  • Selection of appropriate antibodies with minimal cross-reactivity

  • Optimization of coupling protocols for microsphere-based assays

  • Validation using known positive and negative samples

  • Determination of decision limits for each biomarker

  • Evaluation of sensitivity and specificity using receiver operating characteristic (ROC) analysis

The development of such assays would enable more comprehensive protein interaction studies and potentially reveal functional relationships between TMCO2 and other bovine proteins.

What controls should be included in TMCO2 expression experiments?

Proper experimental controls are essential for reliable TMCO2 research. These should include:

  • Positive controls: Samples with confirmed TMCO2 expression

  • Negative controls: Samples from tissues known not to express TMCO2

  • Technical controls: Standard curves for quantification

  • Reference genes/proteins: For normalization in expression studies

  • Vehicle controls: For treatment studies examining regulation of TMCO2

Including these controls allows for normalization of data and ensures that observed changes in TMCO2 levels are attributable to experimental variables rather than technical artifacts.

How can machine learning approaches improve the analysis of TMCO2 biomarker data?

Machine learning methods can significantly enhance TMCO2 biomarker data analysis. Based on the statistical prediction approaches described for other biomarkers, the k-nearest neighbors (kNN) algorithm could be particularly valuable . Implementation would include:

  • Feature selection to identify the most informative parameters

  • Division of data into training and validation sets

  • Optimization of algorithm parameters

  • Cross-validation to assess predictive performance

  • Calculation of true-positive and false-positive rates

This approach could be especially useful for identifying combinations of TMCO2 with other biomarkers that provide superior predictive power compared to individual markers alone, similar to the biomarker combination approach that achieved 95% true-positive rates in rbST detection studies .

What are the challenges in differentiating natural versus recombinant forms of bovine TMCO2?

Differentiating between natural and recombinant forms of bovine TMCO2 presents several methodological challenges:

  • Sequence similarity: Recombinant proteins are often designed to mimic natural sequences

  • Post-translational modifications: Differences may exist in glycosylation patterns

  • Conformational differences: Expression systems may yield proteins with subtle structural variations

  • Antibody specificity: Development of antibodies that can distinguish between natural and recombinant forms

A potential approach to address these challenges would be to develop immunoassays targeting epitopes unique to the recombinant form, such as fusion tags or junction regions, similar to the approach used for detecting antibodies against rbST . Additionally, mass spectrometry methods could be employed to detect subtle differences in protein structure or modifications.

How should contradictory TMCO2 expression data from different studies be reconciled?

Contradictory data on TMCO2 expression across studies is a common challenge in protein research. Based on approaches used in other fields, researchers should:

  • Evaluate methodological differences between studies (sample preparation, detection methods, quantification approaches)

  • Consider biological variables (animal age, breed, physiological state)

  • Assess statistical power and sample sizes

  • Examine potential confounding factors

For example, in studies of rbST biomarkers, significant differences in antibody response were observed between animals of different ages, with older animals showing higher and more persistent responses . Similar age-dependent variations might explain contradictory findings in TMCO2 research. A meta-analysis approach combining data from multiple studies could help identify consistent patterns amid seemingly contradictory results.

What are the recommended validation criteria for TMCO2 detection methods in regulatory contexts?

For regulatory applications, TMCO2 detection methods should meet validation criteria similar to those established for other bovine protein biomarkers. Based on the requirements described for rbST detection methods, validation should include:

  • Determination of decision limits for positive/negative classification

  • Achievement of at least 95% true-positive rate (less than 5% false-compliant results) in accordance with Commission Decision 2002/657/EC requirements for screening methods

  • Evaluation using independent sample sets for model building and validation

  • Assessment of specificity through testing of potential cross-reactive substances

  • Determination of method robustness across different sample matrices

These validation approaches ensure that TMCO2 detection methods are reliable for potential regulatory applications in veterinary medicine or food safety contexts.

How can inter-laboratory standardization of TMCO2 assays be achieved?

Achieving inter-laboratory standardization for TMCO2 assays requires:

  • Development of certified reference materials for TMCO2

  • Establishment of standard operating procedures (SOPs) for sample collection, storage, and processing

  • Implementation of quality control procedures

  • Organization of proficiency testing programs

  • Harmonization of data analysis and reporting formats

The approach should follow established protocols for biomarker standardization, ensuring that TMCO2 measurements are comparable across different laboratories and studies. This standardization is essential for building a consistent body of knowledge about TMCO2 biology and function.

What statistical models are most appropriate for analyzing time-course TMCO2 expression data?

Time-course expression data for TMCO2 requires specialized statistical approaches:

Statistical ModelApplicationAdvantagesLimitations
Repeated Measures ANOVAComparing treatment effects over timeAccounts for within-subject correlationRequires complete data sets
Linear Mixed ModelsAnalyzing hierarchical data with missing valuesHandles unbalanced designs and missing dataMore complex to implement
Time Series AnalysisDetecting temporal patterns in expressionIdentifies cyclical patterns and trendsRequires equally spaced time points
Longitudinal Growth ModelsModeling individual response trajectoriesCaptures individual variation in responsesRequires larger sample sizes

The choice of model should be guided by experimental design, data structure, and research questions. As observed in biomarker studies for rbST, temporal patterns of protein expression can be complex and individual-specific, necessitating appropriate statistical tools to capture this complexity .

How should researchers address inter-individual variability in TMCO2 expression studies?

Inter-individual variability is a significant challenge in protein expression studies. Based on approaches used in rbST biomarker research, strategies to address this variability include:

  • Increasing sample sizes to improve statistical power

  • Stratifying analysis by relevant biological factors (age, breed, sex)

  • Employing statistical methods that account for random effects

  • Using each animal as its own control when possible (before/after designs)

  • Reporting individual-level data alongside group averages

As observed in the rbST studies, significant inter-individual differences in biomarker responses were noted, with some animals showing strong responses and others minimal changes despite identical treatments . Researchers should anticipate similar variability in TMCO2 studies and design experiments accordingly.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.