Recombinant Bovine Transmembrane protein 106A (TMEM106A)

Shipped with Ice Packs
In Stock

Description

Function and Expression of TMEM106A

TMEM106A is highly expressed in myeloid cells, particularly macrophages, where it plays a crucial role in modulating immune responses. Upon activation, TMEM106A up-regulates the expression of CD80, CD86, CD69, and MHC II on macrophages, leading to the release of pro-inflammatory cytokines such as TNF-α and IL-6 . This suggests that TMEM106A is involved in the activation and polarization of macrophages towards an inflammatory phenotype.

Cell TypeFunctionEffect
MacrophagesUp-regulates CD80, CD86, CD69, and MHC IIEnhances immune response
MacrophagesInduces release of TNF-α and IL-6Promotes inflammation

Antiviral Properties of TMEM106A

TMEM106A has been identified as an antiviral factor that inhibits the release of enveloped viruses from the cell surface . It also interferes with the attachment of certain viruses, such as EV-A71, by associating with SCARB2, a receptor used by these viruses to enter host cells . This antiviral activity highlights the potential of TMEM106A in developing therapeutic strategies against viral infections.

VirusEffect of TMEM106A
EV-A71Inhibits attachment and replication
CV-A16Reduces replication
CV-A10No effect

Research Findings and Implications

Studies on TMEM106A, primarily from human and mouse models, indicate its involvement in immune modulation and antiviral defense. The knockout of TMEM106A in mice results in increased sensitivity to lipopolysaccharide-induced septic shock, suggesting a protective role in inflammatory responses . The antiviral properties of TMEM106A make it a candidate for further research in viral infection control.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM106A; Transmembrane protein 106A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-261
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM106A
Target Protein Sequence
MGETFSQLASQKDENKLILPPNPAFGSKAASYSSMGNSRPFFSCVPCERAAGAGFVTCPT CQGSGEIPRELEKQLVALIPYGDQRLKPRHTKLSVFLAVSICLVTSSLIIFFLFPRTIAV QPVGLNSSTVATDEANVYLNITSILNISNNNYCPITVTQLTIEVLHLSLVVGQVSHSLLL HIGPLASEQMFYAVTNRINDENTYKICTWLEIKVHHVLLYIQGTLTYSYLSRSEQLVFQS YEYVDCRGNTSVPHLLVSHPP
Uniprot No.

Target Background

Function

This recombinant Bovine Transmembrane protein 106A (TMEM106A) activates macrophages, polarizing them into M1-like macrophages via the MAPK and NF-κB signaling pathways. Activation upregulates the expression of CD80, CD86, CD69, and MHC II on macrophages, and induces the release of pro-inflammatory cytokines such as TNF, IL-1β, IL-6, CCL2, and nitric oxide. It may also inhibit proliferation and migration.

Database Links
Protein Families
TMEM106 family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the basic structure of TMEM106A protein?

TMEM106A is a type II transmembrane protein consisting of three main regions: a cytoplasmic N-terminal region (amino acids 1-95), a transmembrane region (amino acids 96-115), and an extracellular C-terminal region (amino acids 116-262) . This structural arrangement positions the N-terminus inside the cell and the C-terminus outside, which is crucial for its biological functions. The protein localizes primarily to the plasma membrane and mitochondria . The extracellular C-terminal domain appears to be particularly important for TMEM106A's interactions with other proteins and its antiviral activities .

What are the primary biological functions of TMEM106A?

TMEM106A has several identified biological functions:

  • Antiviral activity: TMEM106A restricts both enveloped and non-enveloped viruses through different mechanisms. For enveloped viruses like HIV-1, it traps viral particles at the cell surface, preventing their release . For non-enveloped viruses like EV-A71, it interferes with virus binding to host cell receptors .

  • Tumor suppression: TMEM106A functions as a tumor suppressor gene in various cancer cell lines. Its expression is often silenced by promoter region hypermethylation in cancers such as gastric cancer . When overexpressed, it suppresses cell growth and induces apoptosis through activation of caspase pathways .

  • Immune regulation: In macrophages, TMEM106A plays a role in regulating M1 polarization and pro-inflammatory functions. Its activation leads to upregulation of co-stimulatory molecules and the release of pro-inflammatory cytokines .

How is TMEM106A expression regulated in normal tissues?

TMEM106A expression is regulated through several mechanisms:

How does TMEM106A restrict different types of viruses?

TMEM106A employs distinct mechanisms to restrict different virus types:

  • Enveloped viruses: For viruses like HIV-1, TMEM106A is incorporated into virion particles during assembly. Through intermolecular interactions of its C-terminal domains on both the virion particle and plasma membrane, it physically tethers newly formed virions to the cell surface, preventing their release . This mechanism is similar to but distinct from another restriction factor, BST-2.

  • Non-enveloped viruses: For enteroviruses like EV-A71, TMEM106A interferes with virus attachment to host cells. It associates with the cellular receptor SCARB2 and blocks the virus from binding to this receptor . This mechanism specifically inhibits SCARB2-mediated viral infection.

Virus TypeRestriction MechanismKey Domains InvolvedViral Countermeasures
Enveloped (e.g., HIV-1)Traps virions at cell surfaceC-terminal domainHIV-1 Env interacts with TMEM106A
Non-enveloped (e.g., EV-A71)Blocks receptor bindingExtracellular regionNot reported

What experimental approaches are used to assess TMEM106A's antiviral activity?

Several methodological approaches have been validated for studying TMEM106A's antiviral functions:

  • Virus infection assays: Researchers typically express TMEM106A in susceptible cell lines, then challenge with reporter viruses (e.g., EV-A71-GFP) to measure infection rates by flow cytometry or fluorescence microscopy .

  • Binding and endocytosis assays: To distinguish between effects on virus binding versus entry, researchers conduct experiments at different temperatures. Virus binding is assessed by incubating cells with virus at 4°C, while endocytosis is evaluated by shifting to 37°C after binding . The bound or internalized viruses are detected by immunofluorescence using virus-specific antibodies.

  • RNA transfection assays: To determine if TMEM106A affects post-entry stages of viral replication, viral genomic RNA can be transfected directly into cells, bypassing the entry process . This approach can isolate effects on viral genome replication from effects on entry.

  • Co-immunoprecipitation: Protein-protein interactions between TMEM106A and viral components or cellular receptors can be assessed using co-immunoprecipitation followed by Western blotting . This technique helps identify molecular mechanisms of restriction.

  • Truncation and domain mapping: Expressing different truncated forms of TMEM106A can identify which domains are critical for antiviral activity .

How can researchers overcome technical challenges in studying TMEM106A-virus interactions?

Common technical challenges and their solutions include:

  • Expression level variations: Stable cell lines expressing consistent levels of TMEM106A are preferable to transient transfection for reproducible results. Consider using inducible expression systems to control expression levels .

  • Species-specific differences: TMEM106A orthologs from different species may have varying antiviral activities. When studying bovine TMEM106A, compare its activity to human and mouse orthologs to understand evolutionary conservation of function .

  • Distinguishing direct and indirect effects: Use RNA transfection in parallel with virus infection to differentiate between effects on entry versus replication . Additionally, employ single-cycle infection assays to isolate specific stages of the viral life cycle.

  • Visualizing virus-TMEM106A interactions: For high-resolution imaging of interactions, consider techniques like proximity ligation assay (PLA) or super-resolution microscopy, which can detect molecular proximities below the diffraction limit.

  • Assessing functional relevance: Complement in vitro studies with TMEM106A knockdown experiments in primary cells to validate physiological relevance .

What methodologies are used to study TMEM106A's tumor suppressor functions?

Researchers investigating TMEM106A's role in cancer employ several approaches:

  • Methylation-specific PCR (MSP): This technique detects the methylation status of the TMEM106A promoter in tumor samples and correlates it with expression levels . Bisulfite sequencing provides more detailed information about specific CpG sites that are methylated.

  • Expression restoration experiments: Researchers can restore TMEM106A expression in cancer cell lines where it is silenced to observe effects on cell proliferation, apoptosis, and other cancer-related phenotypes .

  • Apoptosis pathway analysis: Western blotting for cleaved caspases (caspase-2, caspase-9, caspase-3), BID cleavage, and PARP inactivation helps elucidate the mechanism by which TMEM106A induces apoptosis .

  • Xenograft models: To assess in vivo tumor suppression, cancer cells with restored TMEM106A expression can be implanted in immunodeficient mice to monitor tumor growth compared to control cells .

  • Clinical correlation studies: Analyzing TMEM106A methylation or expression in clinical samples and correlating with patient characteristics (smoking history, metastasis) and outcomes provides insights into its role in cancer progression .

How can researchers differentiate between TMEM106A's direct tumor suppression effects and indirect immune-mediated effects?

This is a critical question for cancer research involving TMEM106A. Several approaches can help distinguish direct versus immune-mediated effects:

  • In vitro versus in vivo models: Direct tumor suppressor effects can be observed in isolated cancer cell cultures, while immune-mediated effects require intact immune systems. Compare results from cell line studies with immunocompetent animal models.

  • Cell-autonomous effects: Use co-culture systems where TMEM106A-expressing cancer cells are physically separated from immune cells by semi-permeable membranes to determine if effects require direct contact or are mediated by soluble factors.

  • Conditional knockout models: Develop tissue-specific or cell-type-specific TMEM106A knockout models to determine whether effects stem from expression in tumor cells or immune cells.

  • Mechanistic separation: TMEM106A's tumor suppression involves caspase activation and apoptosis induction , while its immune functions involve NF-κB pathway activation and cytokine production . Measure these distinct downstream pathways to identify the predominant mechanism in a given context.

  • Timing analysis: Direct tumor suppression effects typically occur rapidly after TMEM106A expression, while immune-mediated effects may take longer due to the need for immune cell recruitment and activation.

What techniques are useful for studying TMEM106A's role in macrophage polarization?

TMEM106A plays a significant role in macrophage activation and polarization toward the M1 phenotype . Researchers can employ these methodologies:

  • Flow cytometry analysis: Measure surface markers of macrophage activation (CD80, CD86, CD69, MHC II) following TMEM106A activation or inhibition .

  • Cytokine profiling: Quantify the production of M1-associated cytokines (TNF-α, IL-1β, IL-6) and M2-associated cytokines (IL-10) using ELISA or multiplex assays after TMEM106A manipulation .

  • Gene expression analysis: Assess the transcription of M1 markers (iNOS) and M2 markers (ARGINASE-1) by qRT-PCR or RNA-seq following TMEM106A stimulation .

  • Signaling pathway investigation: Monitor the phosphorylation status of key signaling molecules (STAT1, STAT6, ERK-1/2, JNK, p38 MAPK, NF-κB p65) by Western blotting to understand the molecular mechanisms of TMEM106A-induced polarization .

  • Functional assays: Evaluate macrophage functions such as phagocytosis, bacterial killing, and antigen presentation capacity after TMEM106A activation or silencing .

ParameterM1 Polarization (TMEM106A activation)M2 Polarization
Surface markers↑ CD80, CD86, CD69, MHC II↑ CD206, CD163
Cytokine production↑ TNF-α, IL-1β, IL-6, NO↑ IL-10, TGF-β
Signaling pathways↑ p-STAT1, p-ERK, p-JNK, p-p38, p-NF-κB↑ p-STAT6
Gene expression↑ iNOS, IL-12, CXCL9/10/11↑ ARGINASE-1, YM1, FIZZ1

How can researchers reconcile TMEM106A's dual roles in antiviral immunity and macrophage activation?

TMEM106A's involvement in both direct antiviral activity and macrophage activation raises interesting questions about its evolved functions. Researchers can address this duality through:

  • Comparative domain analysis: Determine if different domains of TMEM106A mediate different functions. The extracellular domain appears critical for antiviral activity , while signaling domains may be more important for macrophage activation .

  • Temporal regulation studies: Investigate if TMEM106A's different functions are temporally regulated during infection. Initial direct antiviral effects might be followed by immune activation functions.

  • Pathway inhibition experiments: Use specific inhibitors of MAPK or NF-κB pathways to block macrophage activation effects while preserving antiviral functions, or vice versa, to dissect the independence of these functions .

  • Evolutionary analysis: Compare TMEM106A sequences across species to identify conserved domains that might reflect evolutionary pressure from pathogens versus immune regulation needs.

  • Context-dependent studies: Examine TMEM106A functions in different cell types and in response to different stimuli to understand how cellular context influences its primary role.

What are the most promising approaches for studying species-specific differences in TMEM106A function?

Understanding species-specific differences in TMEM106A function is crucial for translating findings between model systems:

  • Comparative sequence and structure analysis: Align TMEM106A sequences from bovine, human, mouse, and other species to identify conserved and divergent regions that might explain functional differences .

  • Cross-species complementation: Express bovine TMEM106A in human or mouse cells lacking endogenous TMEM106A to determine if it can functionally substitute for the host species protein .

  • Domain swapping experiments: Create chimeric proteins containing domains from bovine and human or mouse TMEM106A to map species-specific functional domains .

  • Receptor interaction studies: Compare the interaction of bovine TMEM106A with bovine versus human cellular proteins (e.g., SCARB2) to understand species barriers to function .

  • Species-specific virus restriction assays: Test bovine TMEM106A against bovine viruses compared to human TMEM106A against human viruses to assess co-evolutionary adaptations .

How can researchers effectively design TMEM106A constructs for different experimental applications?

Based on structural and functional knowledge of TMEM106A, researchers should consider these design principles:

What are the key research questions about TMEM106A that remain unresolved?

Despite significant progress, several important questions about TMEM106A warrant further investigation:

  • Physiological regulation: How is TMEM106A expression and function regulated in vivo during viral infection, inflammation, or cancer development? What transcription factors control its basal and induced expression?

  • Structural insights: What is the three-dimensional structure of TMEM106A, particularly its extracellular domain that mediates both antiviral activity and self-interaction?

  • Viral countermeasures: Beyond HIV-1 Env, do other viruses encode antagonists of TMEM106A? How do these antagonisms work at the molecular level?

  • Signaling mechanisms: How does TMEM106A activate MAPK and NF-κB pathways in macrophages? Does it interact with specific adaptor proteins to initiate signaling?

  • Therapeutic potential: Could modulation of TMEM106A activity be harnessed for antiviral therapy, cancer treatment, or immunomodulation? What would be potential approaches to target it specifically?

  • Bovine-specific functions: Are there unique aspects of bovine TMEM106A function related to bovine-specific pathogens or immune responses that differ from human or mouse orthologs?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.