Recombinant Bovine Transmembrane protein 129 (TMEM129)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine Transmembrane Protein 129 (TMEM129)

Recombinant Bovine Transmembrane Protein 129 (TMEM129) is a protein produced through recombinant DNA technology in an in vitro E. coli expression system. This protein is a member of the transmembrane protein family and functions as an E3 ubiquitin ligase, playing a crucial role in the endoplasmic reticulum-associated degradation (ERAD) pathway. TMEM129 is involved in the ubiquitination and degradation of proteins, particularly those associated with the major histocompatibility complex class I (MHC-I) molecules, which are critical for immune recognition.

Production and Availability

Recombinant Bovine TMEM129 is produced in an in vitro E. coli expression system, ensuring high purity and availability for research purposes . The product details include:

CodeDescription
CSB-CF023696BORecombinant Bovine Transmembrane protein 129 (TMEM129)
SourceIn vitro E. coli expression system
PurityHigh purity
ContactAvailable for purchase; inquiries can be made via phone or online chat

Role in Immune Modulation

TMEM129 is crucial for the function of viral proteins like US11, which downregulate MHC-I expression on the cell surface. This process is essential for immune evasion by viruses such as human cytomegalovirus (HCMV) .

Mechanism of Action

TMEM129 facilitates the ubiquitination of MHC-I molecules, marking them for degradation. The RING domain of TMEM129 is essential for this process, as it recruits the E2 enzyme UBE2J2 to initiate ubiquitination .

Experimental Validation

Studies using gene-trap clones and shRNA-mediated depletion have demonstrated the necessity of TMEM129 for US11-mediated MHC-I degradation. Overexpression of TMEM129 enhances this degradation, while its depletion leads to increased MHC-I expression on the cell surface .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM129; E3 ubiquitin-protein ligase TM129; RING-type E3 ubiquitin transferase TM129
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-362
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
TMEM129
Target Protein Sequence
EFHSAGLTVQNLLSGWLGSEDAAFVPYHLRRTAATLLCHSLLPLGYYVGMCFAASEKQLY YPSQTPETWRAFLLLALMLPAIACTLIYYWSRDHWACHPLARTLALYALPRSGWQAVASS VNTEFRRIDKFATGVPGARVIVTDTWVMKVTTYRVHVAQQQDVRLTVTEAQQHELSPDSH LPVQLLTIRVASANPAVPAFHIRLNSTEYGELCEKLRAPIRSAANVVIHQSLGDLFLETF ASLVEVNPAYSVPSSQDLEACIGCMQTQASVKLVKTCQEVAVGECQQCYCRPMWCLTCMG KWFASRQDPQRPDTWLASRVPCPTCRARFCVLDVCAVR
Uniprot No.

Target Background

Function

Recombinant Bovine Transmembrane protein 129 (TMEM129) is an E3 ubiquitin-protein ligase involved in ER-associated protein degradation. It preferentially interacts with the E2 enzyme UBE2J2. Viral US11 proteins exploit TMEM129 to mediate the degradation of HLA class I proteins.

Database Links

KEGG: bta:518991

UniGene: Bt.5633

Protein Families
TMEM129 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is TMEM129 and what is its basic structure?

TMEM129 is an evolutionarily conserved transmembrane protein that functions as an E3 ubiquitin ligase. The protein consists of 362 amino acids in humans and contains three predicted transmembrane domains with a long C-terminal tail . TMEM129 is localized to the endoplasmic reticulum (ER) as confirmed by colocalization studies with the ER marker calnexin . The protein's most distinctive feature is its C-terminal domain, which contains an unusual RING finger motif.

Unlike conventional RING domains that typically contain a mixture of cysteine and histidine residues (C3HC4 in RING-CH or C3H2C3 in RING-H2), TMEM129 possesses an unconventional C4C4-type RING finger domain that contains only cysteine residues for zinc coordination . This rare "cysteine-only" RING domain also contains extended loops between its zinc-coordinating cysteines (amino acids 289-308 and 323-345) and still maintains the canonical E2 binding site features, including an isoleucine residue between the first two cysteines, a tryptophan in position 4 of the second loop, and a proline between the final two cysteine residues .

How evolutionarily conserved is TMEM129 across species?

TMEM129 demonstrates significant evolutionary conservation throughout the holozoan lineage. Although it lacks a yeast ortholog, TMEM129 can be traced back to the unicellular metazoan ancestor Capsaspora owczarzaki . This conservation suggests an important functional role that has been maintained throughout animal evolution.

The conserved nature of TMEM129 is further evidenced by the availability of recombinant forms from various species including bovine, mouse, and Xenopus tropicalis . The preservation of TMEM129's unusual RING-C2 domain across diverse species indicates that this protein likely originated from a classic RING E3 ligase rather than being part of a larger RING-C2 ligase family . This evolutionary conservation makes comparative studies between species particularly valuable for understanding fundamental aspects of TMEM129 function.

What is the primary function of TMEM129?

TMEM129 functions as an E3 ubiquitin ligase that plays a crucial role in endoplasmic reticulum-associated degradation (ERAD) . It is involved in the quality control of newly synthesized proteins, particularly in targeting misfolded secretory proteins for retrotranslocation across the ER membrane to the cytosol for proteasomal degradation .

In vitro ubiquitination assays have demonstrated that TMEM129 possesses ubiquitin ligase activity dependent on its RING domain. When incubated with E1 UBA1, the E2 UBE2D3, S5a (Rpn10) protein substrate, ubiquitin, and ATP, TMEM129 catalyzes the formation of poly-ubiquitinated S5a species . This activity is completely abolished when the RING domain is removed . Even in the absence of a specific substrate, TMEM129 can induce the formation of polyubiquitin chains, further confirming its intrinsic E3 ligase activity .

What expression systems are most effective for producing recombinant TMEM129?

Recombinant TMEM129 can be produced using several expression systems, each with advantages depending on the research application. For bovine TMEM129 specifically, multiple expression systems have been utilized:

  • E. coli expression system: The bacterial expression system is often used for producing the full-length or partial protein with N-terminal His tags . This system offers high protein yields and is cost-effective, but may lack some post-translational modifications present in mammalian systems.

  • Cell-free expression systems: These systems have been successfully employed for producing recombinant bovine TMEM129 with high purity (≥85% as determined by SDS-PAGE) . Cell-free systems allow for rapid protein production and can be advantageous when dealing with potentially toxic proteins.

  • Yeast, baculovirus, and mammalian cell expression systems: These are also viable options for TMEM129 expression, particularly when post-translational modifications or proper protein folding are critical considerations .

For functional studies, it's worth noting that exogenous HA-tagged TMEM129 has been successfully expressed in KBM7 cells and effectively restored functionality in TMEM129-deficient systems . The choice of expression system should be guided by the specific experimental requirements, particularly regarding protein folding, post-translational modifications, and functional assays.

What purification strategies yield the highest purity and activity for recombinant TMEM129?

For optimal purification of recombinant TMEM129, a multi-step approach is recommended based on the protein's properties and tag system:

  • Initial capture using affinity chromatography: For His-tagged TMEM129, immobilized metal affinity chromatography (IMAC) using Ni-NTA columns provides effective initial purification . For FLAG- and Strep-tag II-tagged versions, corresponding affinity resins can be used for immunoprecipitation and purification .

  • Buffer optimization: The storage buffer composition significantly impacts protein stability. Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been shown to maintain TMEM129 stability during storage . This buffer composition helps prevent protein aggregation and preserves functional activity.

  • Handling and storage recommendations: After purification, TMEM129 is typically provided as a lyophilized powder . Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended. For long-term storage, adding glycerol to a final concentration of 5-50% (optimally 50%) and aliquoting for storage at -20°C/-80°C minimizes freeze-thaw damage . Repeated freeze-thaw cycles should be avoided, with working aliquots stored at 4°C for up to one week .

The purity of commercially available recombinant TMEM129 typically exceeds 90% as determined by SDS-PAGE , with other sources reporting ≥85% purity . Higher purity is critical for functional assays, particularly in vitro ubiquitination assays.

How can researchers assess the functional activity of recombinant TMEM129?

Assessing the functional activity of recombinant TMEM129 is critical to ensure that the protein retains its E3 ligase activity. Several complementary approaches can be employed:

  • In vitro ubiquitination assays: The gold standard for confirming E3 ligase activity involves incubating purified TMEM129 with E1 (UBA1), an E2 enzyme (such as UBE2D3 or UBE2J2), a protein substrate (such as S5a/Rpn10), ubiquitin, and ATP . Formation of polyubiquitinated substrate species, detectable by Western blot, confirms functional activity. Importantly, RING-less TMEM129 should be used as a negative control, as it completely lacks ubiquitination activity .

  • Polyubiquitin chain formation assay: Even in the absence of a specific substrate, functional TMEM129 can catalyze the formation of polyubiquitin chains when incubated with E1, E2, ubiquitin, and ATP . This provides a simplified assay for confirming basic catalytic function.

  • Complementation assays in cellular models: For functional assessment in cellular contexts, TMEM129-deficient cells (such as TMEM129 gene-trap clones) can be complemented with exogenous TMEM129 . Restoration of ERAD activity or MHC-I degradation in US11-expressing cells provides strong evidence of functional activity. Both endogenous MHC-I levels (by immunoblot) and cell surface HLA-A2 expression (by flow cytometry) can serve as readouts .

  • Co-immunoprecipitation with known interaction partners: Functional TMEM129 interacts with specific partners including Derlin-1 and UBE2J2 . Verification of these interactions through co-immunoprecipitation can provide additional confirmation of proper protein folding and function.

What is the role of TMEM129 in endoplasmic reticulum-associated degradation (ERAD)?

TMEM129 functions as a critical E3 ubiquitin ligase within the ERAD pathway, which is responsible for identifying, retrotranslocating, and degrading misfolded proteins from the ER . As newly synthesized proteins undergo strict quality control checkpoints in the ER, those that fail to fold properly must be eliminated to prevent cellular dysfunction. TMEM129 plays a crucial role in this process by facilitating the ubiquitination of these misfolded proteins, marking them for subsequent proteasomal degradation.

The mechanism of TMEM129 in ERAD involves its association with Derlin-1, an essential component of the ERAD machinery . Through this association, TMEM129 forms part of a novel ERAD complex that specifically recruits the E2 ubiquitin-conjugating enzyme UBE2J2 to ubiquitinate substrate proteins . This specificity in E2 recruitment represents an important aspect of TMEM129's function in the ERAD pathway.

Research using TMEM129-deficient cells has demonstrated that this protein is essential for the turnover of specific misfolded secretory proteins within the ERAD pathway . The absence of TMEM129 results in the accumulation of these proteins in the ER, indicating its critical role in maintaining ER homeostasis and protein quality control.

How does human cytomegalovirus (HCMV) exploit TMEM129 for immune evasion?

Human cytomegalovirus (HCMV) has evolved sophisticated mechanisms to evade immune detection, one of which involves the hijacking of TMEM129 to degrade major histocompatibility complex class I (MHC-I) molecules . This strategy prevents infected cells from presenting viral antigens to cytotoxic T lymphocytes, thereby avoiding immune recognition and clearance.

The viral protein US11 plays a central role in this process by redirecting newly synthesized MHC-I molecules to the ERAD pathway for degradation . TMEM129 has been identified as absolutely essential for US11-mediated MHC-I degradation based on several lines of evidence:

  • In TMEM129 gene-trap (GT) cells expressing US11, MHC-I degradation is completely blocked, resulting in the restoration of MHC-I protein levels .

  • Exogenous expression of HA-tagged TMEM129 in US11 TMEM129 GT cells restores US11 activity, causing complete loss of cell surface HLA-A2 .

  • TMEM129 is not only essential but also rate-limiting for US11-mediated MHC-I degradation, as overexpression of TMEM129 enhances MHC-I down-regulation beyond basal levels .

  • siRNA-mediated depletion of TMEM129 rescues GFP-HLA-A2 expression in HeLa-US11 cells, confirming a general requirement for TMEM129 in US11 activity across different cell types .

  • In actual HCMV infection using the TB40Bac4 strain (which relies on US11 for MHC-I down-regulation), depletion of TMEM129 prevents the loss of HLA-A2, confirming its critical role in virus-mediated immune evasion .

This exploitation of TMEM129 by HCMV represents a striking example of viral adaptation, where a cellular quality control mechanism is repurposed to facilitate immune evasion.

What distinguishes the US11 pathway from other HCMV immune evasion mechanisms?

The US11 pathway represents one of several immune evasion strategies employed by HCMV, but it possesses distinctive characteristics that set it apart:

  • Absolute dependence on TMEM129: Unlike other HCMV immune evasion mechanisms, the US11 pathway specifically requires TMEM129 for function . This is evidenced by the observation that TMEM129 depletion does not rescue GFP-HLA-A2 in US2-expressing HeLa cells, indicating that US2 (another HCMV immune evasion protein) operates through a TMEM129-independent mechanism .

  • Mechanism of MHC-I retention: In the absence of TMEM129, US11 retains MHC-I molecules in the ER rather than facilitating their degradation . Pulse-chase analysis reveals that in TMEM129-deficient cells expressing US11, MHC-I degradation is prevented, and conformational MHC-I remains mainly EndoH-sensitive (indicating ER residency) and associates with US11 . This retention represents a common strategy employed by many viral proteins to prevent substrate expression.

  • Rate-limiting nature of TMEM129: US11-mediated MHC-I degradation is constrained by available TMEM129, as overexpression of TMEM129 enhances MHC-I down-regulation . This suggests that TMEM129 availability is a potential regulatory point in this immune evasion pathway.

  • Protection of US11 from degradation: Despite facilitating MHC-I degradation through TMEM129, US11 itself is protected from rapid degradation by this E3 ligase . Instead, US11 is turned over by a different ERAD complex involving the HRD1/SEL1L ligase . This selective protection ensures sustained function of the viral protein while targeting host MHC-I for destruction.

Understanding these distinctive features of the US11 pathway provides valuable insights into viral immune evasion strategies and highlights the sophisticated ways in which viruses can manipulate host cellular machinery.

What is known about the E2 enzyme specificity of TMEM129?

TMEM129 demonstrates specific E2 enzyme preferences that are critical to its function as an E3 ubiquitin ligase. Research has identified UBE2J2 as the primary E2 ubiquitin-conjugating enzyme that partners with TMEM129 in the cellular context . This specificity is particularly important in the context of US11-mediated MHC-I degradation, where the TMEM129-UBE2J2 pair is essential for substrate ubiquitination.

In experimental settings, TMEM129 has also been shown to work with the promiscuous E2 enzyme UBE2D3 (also known as UbcH5c) in in vitro ubiquitination assays . When incubated with E1 UBA1, UBE2D3, substrate, ubiquitin, and ATP, TMEM129 successfully catalyzes the formation of polyubiquitinated substrate species . This ability to function with UBE2D3 in vitro suggests some flexibility in E2 partnership under certain conditions.

The structural basis for TMEM129's E2 specificity likely resides in its unusual C4C4 RING domain, which contains the canonical E2 binding elements despite its atypical zinc-coordinating residue composition . The presence of specific conserved residues - an isoleucine between the first two cysteines, a tryptophan in position 4 of the second loop, and a proline between the final two cysteine residues - provides the structural framework for E2 interaction .

Future research examining the structural determinants of TMEM129-E2 specificity and investigating whether this E3 ligase can partner with other E2 enzymes under specific cellular conditions would further enhance our understanding of its functional versatility.

How does the unusual C4C4 RING domain of TMEM129 affect its catalytic mechanism?

The C4C4 RING domain of TMEM129 represents a rare variant among E3 ubiquitin ligases and likely influences its catalytic mechanism in several important ways:

Further structural and biochemical studies are needed to fully elucidate how this unusual RING domain configuration affects TMEM129's catalytic mechanism, substrate specificity, and regulation.

What experimental approaches can differentiate between bovine and human TMEM129 functional properties?

Investigating functional differences between bovine and human TMEM129 requires a systematic comparative approach using complementary techniques:

  • Sequence and structural analysis: Comparative bioinformatic analysis of bovine and human TMEM129 sequences can identify conserved domains and species-specific variations. Particular attention should be paid to differences in the transmembrane domains, RING finger region, and potential post-translational modification sites. Homology modeling and structural prediction tools can help visualize these differences and generate hypotheses about their functional implications.

  • Cross-species complementation assays: Human TMEM129-deficient cells (such as TMEM129 gene-trap clones) can be complemented with either human or bovine TMEM129 to assess functional conservation . Measuring the ability of bovine TMEM129 to restore ERAD activity or support US11-mediated MHC-I degradation in human cells would provide direct evidence of functional equivalence or divergence.

  • Comparative biochemical assays: Side-by-side in vitro ubiquitination assays using purified recombinant human and bovine TMEM129 can reveal differences in catalytic activity, E2 enzyme preference, or substrate specificity . These assays should include kinetic measurements to quantify potential differences in catalytic efficiency.

  • Interaction partner identification: Comparative immunoprecipitation followed by mass spectrometry can identify species-specific interaction partners for human and bovine TMEM129. Differences in the interactome may reveal specialized functions that have evolved in each species.

  • Species-specific regulatory mechanisms: Analysis of post-translational modifications and their effects on activity may reveal species-specific regulatory mechanisms. Techniques such as phosphoproteomics, ubiquitin remnant profiling, or other post-translational modification analyses can identify differences in how human and bovine TMEM129 are regulated.

  • Cross-species viral susceptibility: Given TMEM129's role in HCMV immune evasion in human cells, comparing how bovine and human TMEM129 interact with species-specific viral proteins (such as bovine herpesvirus homologs of US11) could reveal co-evolutionary adaptations in host-pathogen interactions.

These approaches collectively would provide a comprehensive view of the functional conservation and divergence between bovine and human TMEM129, potentially revealing species-specific adaptations in ERAD and immune defense mechanisms.

What are common challenges in working with recombinant TMEM129 and how can they be addressed?

Researchers working with recombinant TMEM129 often encounter several technical challenges that can be addressed through specific strategies:

  • Protein solubility and aggregation: As a membrane protein with multiple transmembrane domains, TMEM129 can present solubility challenges . To address this:

    • Include 6% trehalose in storage buffers to prevent aggregation

    • Optimize reconstitution conditions using deionized sterile water at concentrations of 0.1-1.0 mg/mL

    • Add glycerol (5-50%, optimally 50%) for long-term storage to prevent precipitation

    • Consider using detergents or lipid nanodiscs for functional studies of the full-length protein

  • Maintaining functional activity: E3 ligases can lose activity during purification and storage:

    • Minimize freeze-thaw cycles by preparing single-use aliquots

    • Store working aliquots at 4°C for no more than one week

    • Include reducing agents in buffers to maintain the integrity of the cysteine-rich RING domain

    • Confirm activity through in vitro ubiquitination assays before experimental use

  • Expression of full-length protein: Expressing the complete 362-amino acid protein with all three transmembrane domains can be challenging:

    • Test multiple expression systems (E. coli, cell-free, yeast, baculovirus, mammalian)

    • Consider expressing functional domains (such as the RING domain) separately for specific applications

    • Optimize codon usage for the expression system

    • Use fusion tags that enhance solubility (such as MBP or SUMO) in addition to purification tags

  • Verification of proper folding: Ensuring correct folding of the unusual C4C4 RING domain is critical:

    • Include zinc in purification and storage buffers

    • Verify domain integrity through circular dichroism or thermal shift assays

    • Confirm functionality through E2 binding and ubiquitination activity assays

  • Specificity in functional assays: When assessing TMEM129 function:

    • Include appropriate controls such as RING-less TMEM129 mutants

    • Verify E2 enzyme specificity by testing multiple E2s (particularly UBE2J2 and UBE2D3)

    • Consider the influence of experimental conditions (pH, salt concentration, temperature) on activity

Implementing these strategies can significantly improve the success rate when working with recombinant TMEM129 in research applications.

What quality control parameters should be assessed for recombinant TMEM129 preparations?

Rigorous quality control is essential for ensuring reliable experimental results with recombinant TMEM129. Key parameters to assess include:

  • Purity assessment:

    • SDS-PAGE analysis with Coomassie or silver staining (standard threshold: ≥85-90% purity)

    • Western blot using TMEM129-specific antibodies to confirm identity

    • Mass spectrometry for precise molecular weight determination and contaminant identification

    • Size exclusion chromatography to assess aggregation state and homogeneity

  • Structural integrity:

    • Circular dichroism (CD) spectroscopy to verify secondary structure elements

    • Thermal shift assays to assess protein stability and proper folding

    • Dynamic light scattering (DLS) to evaluate size distribution and aggregation potential

    • Limited proteolysis to confirm proper domain folding and accessibility

  • Functional activity:

    • In vitro ubiquitination assays using defined components (E1, E2, substrate, ubiquitin, ATP)

    • Auto-ubiquitination assays to verify catalytic function

    • E2 binding assays to confirm proper RING domain structure

    • Comparative activity analysis against reference standards or previous lots

  • Contaminant testing:

    • Endotoxin testing for preparations intended for cell-based assays

    • Nucleic acid contamination assessment (A260/A280 ratio)

    • Protease activity assays to detect contaminating proteases

    • Host cell protein (HCP) analysis for preparations from eukaryotic expression systems

  • Stability assessment:

    • Accelerated stability studies under various storage conditions

    • Freeze-thaw stability to determine optimal aliquoting strategy

    • Activity retention testing after storage at recommended conditions

    • Long-term stability monitoring with periodic functional testing

A quality control certificate should document these parameters, including exact measurements of purity (≥85-90% by SDS-PAGE), concentration, and functional activity compared to reference standards . Establishing these quality control parameters ensures consistency between experimental batches and facilitates reproducible research outcomes.

How can researchers optimize in vitro ubiquitination assays for TMEM129?

Optimizing in vitro ubiquitination assays for TMEM129 requires careful consideration of multiple parameters to ensure reliable and reproducible results:

  • Component selection and quality:

    • E1 enzyme: Use highly purified UBA1 with verified activity

    • E2 enzyme: Compare UBE2J2 (physiological partner) with UBE2D3 (promiscuous E2 used in vitro)

    • Substrates: For directed assays, use purified known substrates; for activity verification, use model substrates like S5a/Rpn10

    • Ubiquitin: Use fresh preparations of purified ubiquitin; consider tagged versions (His, FLAG, etc.) for enhanced detection

    • ATP regeneration system: Include phosphocreatine and creatine phosphokinase to maintain ATP levels during extended assays

  • Reaction conditions optimization:

    • Buffer composition: Test HEPES, Tris, and phosphate buffers at pH 7.5-8.0

    • Salt concentration: Optimize NaCl or KCl concentration (typically 50-150 mM)

    • Reducing agents: Include DTT or β-mercaptoethanol (1-5 mM) to maintain RING domain integrity

    • Zinc concentration: Supplement with ZnCl₂ (10-50 μM) to ensure proper RING domain folding

    • Detergents: Consider including low concentrations of nonionic detergents (0.01-0.05% Triton X-100) for the full-length protein

  • Kinetics and stoichiometry:

    • Enzyme ratios: Typically use 1:2:10 ratio of E1:E2:E3 (TMEM129)

    • Substrate excess: Maintain 5-10 fold excess of substrate over E3

    • Time course analysis: Sample reactions at multiple time points (0, 5, 15, 30, 60 minutes) to capture reaction kinetics

    • Temperature: Most assays are conducted at 30-37°C; temperature sensitivity should be assessed

  • Controls and validation:

    • Positive control: Include a well-characterized E3 ligase with known activity

    • Negative controls: Include no-E3 control and RING-less TMEM129 mutant

    • ATP dependence: Run parallel reactions without ATP to confirm ATP requirement

    • E2 specificity: Test multiple E2 enzymes to confirm specificity

    • Ubiquitin variants: Consider K48R or K63R ubiquitin mutants to assess chain linkage specificity

  • Detection and analysis:

    • Western blotting: Use antibodies against the substrate, ubiquitin, or epitope tags

    • Fluorescence-based detection: Consider using fluorescently labeled ubiquitin for quantitative analysis

    • Mass spectrometry: For detailed analysis of ubiquitination sites and chain topology

    • Quantification: Use densitometry of western blots or fluorescence intensity measurements to quantify activity

Optimization through systematic testing of these parameters will yield a robust assay for characterizing TMEM129's E3 ligase activity, substrate specificity, and kinetic properties. The optimized assay can then be used for comparative studies between bovine and human TMEM129 or for screening potential modulators of TMEM129 activity.

What are the key unresolved questions about TMEM129 that warrant further investigation?

Despite significant advances in understanding TMEM129 structure and function, several critical questions remain unanswered and represent promising areas for future research:

  • Structural characterization: The three-dimensional structure of TMEM129, particularly its unusual C4C4 RING domain, remains unresolved. Obtaining crystal or cryo-EM structures would provide invaluable insights into how this atypical RING domain interacts with E2 enzymes and substrates. The extended loops between zinc-coordinating cysteines likely play important functional roles that structural studies could illuminate .

  • Physiological substrates: While TMEM129's role in US11-mediated MHC-I degradation is established , its normal cellular substrates in the absence of viral infection remain largely unknown. Comprehensive substrate identification would clarify TMEM129's physiological function in protein quality control and potentially reveal other cellular pathways involving this E3 ligase.

  • Regulatory mechanisms: How TMEM129 activity is regulated remains poorly understood. Investigation of potential post-translational modifications, protein-protein interactions, or conformational changes that modulate its activity would provide insights into the control of this important ERAD component.

  • Species-specific functions: Comparative studies between bovine, human, and other species' TMEM129 orthologs could reveal evolutionarily conserved functions and species-specific adaptations, particularly in the context of viral immune evasion strategies .

  • Role in disease: The potential involvement of TMEM129 in human diseases beyond viral infection has not been extensively explored. Given its role in protein quality control, TMEM129 dysfunction could contribute to protein misfolding diseases or other pathological conditions associated with ER stress.

Addressing these questions through interdisciplinary approaches combining structural biology, biochemistry, cell biology, and systems-level analyses would significantly advance our understanding of this unique E3 ubiquitin ligase and potentially reveal new therapeutic opportunities targeting ERAD pathways.

What potential applications might emerge from improved understanding of TMEM129?

Enhanced knowledge of TMEM129 structure, function, and regulation could lead to several promising applications:

  • Antiviral therapeutic development: As TMEM129 is essential for HCMV immune evasion through the US11 pathway , selective inhibitors of TMEM129-US11 interaction could restore MHC-I presentation and immune recognition of infected cells. Such inhibitors could represent a novel class of anti-HCMV therapeutics with a unique mechanism of action targeting viral immune evasion rather than viral replication.

  • Protein misfolding disease interventions: Given TMEM129's role in ERAD , modulating its activity could potentially alleviate ER stress in diseases characterized by protein misfolding and aggregation. Selective enhancement or inhibition of TMEM129-mediated degradation of specific substrates could help rebalance proteostasis in conditions like certain neurodegenerative diseases or type 2 diabetes.

  • Biomarker development: Changes in TMEM129 expression or activity could serve as biomarkers for conditions involving ER stress or altered proteostasis. Monitoring TMEM129 status might provide diagnostic or prognostic information in various disease contexts.

  • Biotechnological tools: The unusual C4C4 RING domain of TMEM129 could be engineered to create novel E3 ligases with altered specificity or activity for research applications or targeted protein degradation technologies. TMEM129-based systems might complement existing technologies for induced protein degradation.

  • Comparative immunology applications: Understanding species-specific differences in TMEM129 function could reveal evolutionary adaptations in ERAD and immune defense mechanisms. This knowledge could inform the development of improved animal models for studying human diseases and therapeutic responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.