Recombinant Bovine Transmembrane protein 143 (TMEM143)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, and can serve as a guideline for your reconstitution.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
TMEM143; Transmembrane protein 143
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-457
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM143
Target Protein Sequence
MLHVTRGVWGSIVRVWPLLPSFLGHSRALSSLEAKMGEYRKMWNPTEPRDWAQQYRERHI PFSKEQLLRLLIQEFHSTPAEKAALEEFTAHVDFCTLFHYHHVLTQLQALYDPINPDRET LDQPSLTDPQRLSNEKEVLQALEPLLAQANFSPLTEDTLAYALVVHHPQDEVQVTINLDQ YIYMHFWALGQRVGKMPRKSSVGSKRFFFKSPPAERRYFKRVILAARTKKGHLVLKSFKD TPLEGLEQLLPELKVRTSTLQRAILNVTLIVSGVVFFVNVGMVVLSDLKMATSLLLLLFA AFMGLRAAKMFGHRRSAQALELAHMLYYRSTSNNAELLSALVLRAQDEHTKETLLAHSFL ARRPGGAKGPPEETSQWLQSEVENWLLAQSGCDVAFNGKRALAHLQALPPTVGMYPPPGL PKLDLLATLSSPKSAPSDDNSLEKPLGPAQPSHLVGN
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM143 and what are its key structural characteristics?

TMEM143 (Transmembrane protein 143) is a dual-pass protein containing two transmembrane domains. Based on human TMEM143 studies, the protein is predicted to localize to the mitochondria and shows high expression in both skeletal muscle and heart tissue . The protein architecture includes:

  • Two transmembrane domains (approximately 24 and 16 amino acids in length)

  • A domain of unknown function (DUF3754) containing the transmembrane regions

  • A predicted mitochondrial target peptide at the N-terminus

  • Multiple isoforms resulting from alternative splicing

Human TMEM143 isoform a (the longest variant) is 459 amino acids in length with a molecular weight of 51.6 kDa and an isoelectric point of 9.7 . While bovine TMEM143 likely shares significant structural homology, researchers should note potential species-specific variations that may affect experimental design and interpretation.

How does the gene and transcript structure of TMEM143 inform bovine research applications?

The TMEM143 gene in humans spans 31,882 base pairs on chromosome 19 (19q13.33) on the negative strand. It is neighbored by genes encoding Coiled-coil domain containing 114 (CCDC114) and ER lumen protein-retaining receptor 1 (KDELR1) . Human TMEM143 produces five transcript variants:

VariantLength (nt)Protein ProductKey Features
12577459 aa (isoform a)Full-length, 8 exons
22472424 aa (isoform b)Missing one 5' exon
32382394 aa (isoform c)Missing one 5' exon
42277359 aa (isoform d)Missing two 5' exons
52231NoneNon-coding RNA

When designing primers, expression constructs, or RNA interference experiments with bovine TMEM143, researchers should:

  • Compare bovine and human transcript structures to identify conserved regions

  • Consider targeting multiple variants if investigating functional differences

  • Carefully select amplification regions that avoid splice junctions

  • Account for potential bovine-specific transcript variants not characterized in human studies

What expression systems are most effective for producing recombinant bovine TMEM143?

Based on successful expression of mouse TMEM143, the following approaches are recommended for bovine TMEM143 expression:

Mammalian Expression Systems

HEK293T cells have proven effective for recombinant mouse TMEM143 expression with C-terminal tags (MYC/DDK) . For bovine TMEM143:

  • Consider a C-terminal tag placement to avoid disruption of the N-terminal mitochondrial targeting sequence

  • Use strong promoters such as CMV for high expression levels

  • Implement temperature modulation (30-37°C) to balance expression and proper folding

  • Consider inducible expression systems if the protein shows toxicity at high levels

Expression Optimization Parameters

ParameterRecommended ApproachRationale
Host Cell LineHEK293T (primary choice)Demonstrated success with mouse ortholog
Expression VectorMammalian with C-terminal tagPreserves N-terminal targeting sequence
Culture Conditions72-96 hours post-transfection, 30-37°CAllows sufficient time for expression while minimizing degradation
Purification TagMYC/DDK or His6Enables efficient affinity purification
Buffer SystemPBS-based with glycerolMaintains protein stability during extraction

Researchers should validate expression through Western blotting and conduct small-scale expression trials before scaling up production .

What purification strategies should be employed for recombinant bovine TMEM143?

Purifying recombinant bovine TMEM143 presents challenges due to its transmembrane domains. The following purification workflow is recommended:

Extraction Phase

  • Cell lysis in PBS buffer containing protease inhibitors

  • Membrane isolation via ultracentrifugation (100,000 × g)

  • Membrane solubilization using mild detergents (start with 1% DDM or LMNG)

Purification Phase

  • Affinity chromatography targeting the fusion tag (e.g., MYC/DDK as used with mouse TMEM143)

  • Size exclusion chromatography to remove aggregates

  • Buffer optimization with 0.01-0.05% detergent to maintain solubility

Storage Considerations

  • Aliquot and store at -20°C or -80°C in buffer containing 50% glycerol

  • Avoid repeated freeze/thaw cycles

  • Add stabilizers such as glycerol to prevent aggregation

  • Protect from light exposure during storage if using fluorescent tags such as FITC

For researchers seeking to maximize protein yield and purity, implementing Protein G purification steps as used with antibody preparations may provide additional purification benefits .

How can researchers validate antibodies for bovine TMEM143 detection?

Comprehensive antibody validation is critical for reliable TMEM143 research. The following multi-step validation process is recommended:

Specificity Testing

  • Western blot analysis using recombinant bovine TMEM143 as a positive control

  • Testing in bovine tissues with predicted high expression (skeletal muscle, heart)

  • Pre-absorption controls with recombinant antigen

  • Cross-reactivity assessment with other TMEM family proteins

Application-Specific Validation

ApplicationCritical ParametersValidation Approach
Western BlottingDenaturation conditionsTest multiple buffer/detergent combinations
ELISAAntibody concentrationTitration series to determine optimal dilution
ImmunohistochemistryFixation methodCompare paraformaldehyde vs. methanol fixation
ImmunofluorescenceEpitope accessibilityTest permeabilization conditions

Considerations for Commercial Antibodies

When using commercially available antibodies (e.g., polyclonal anti-TMEM143):

  • Verify the immunogen sequence aligns with bovine TMEM143

  • Check the binding specificity (e.g., antibodies targeting AA 8-278 vs. N-term or C-term)

  • Confirm reactivity across species if using antibodies developed against human TMEM143

  • Test multiple antibody clones targeting different epitopes when possible

What approaches can effectively investigate TMEM143's mitochondrial functions?

Given TMEM143's predicted mitochondrial localization, several methodological approaches can elucidate its function:

Subcellular Localization Studies

  • Co-localization with mitochondrial markers using fluorescently-tagged TMEM143

  • Subcellular fractionation followed by Western blotting

  • Immunoelectron microscopy for precise submitochondrial localization

Functional Mitochondrial Assays

Assay TypeMeasurementRelevance to TMEM143
Oxygen ConsumptionMitochondrial respiration ratesImpact on electron transport chain
Membrane PotentialProton gradient maintenanceRole in mitochondrial membrane integrity
ATP ProductionEnergy metabolismInvolvement in bioenergetics
ROS GenerationOxidative stressPotential protective/regulatory functions
Mitochondrial MorphologyFusion/fission dynamicsStructural roles in mitochondria

Mechanistic Investigations

  • Protein-protein interaction studies with mitochondrial components

  • TMEM143 knockdown/overexpression followed by mitochondrial function assessments

  • Structure-function analysis through mutation of conserved residues

Researchers should consider the dual transmembrane nature of TMEM143 when designing functional studies, as this structural feature suggests potential roles in mitochondrial membrane organization or transport functions .

How do TMEM gene expression patterns inform TMEM143 research in disease models?

While TMEM143-specific disease associations have limited documentation, research on TMEM gene family members provides valuable insights:

Expression Analysis Techniques

  • Single-cell RNA sequencing to identify cell type-specific expression

  • Removal of cell-cycle effects by selecting G1 phase cells for analysis

  • Integration of multiple datasets using harmony-based approaches

  • Dimensional reduction with UMAP and t-SNE methods for visualization

TMEM143 in Disease Contexts

Based on TMEM family studies in cancer:

  • Potential role in tumor suppression/regulation as indicated by protein interaction studies

  • Possible involvement in mitochondrial functions relevant to cancer metabolism

  • Expression changes during developmental trajectories that may inform carcinogenesis mechanisms

Analytical Framework for TMEM143 Disease Studies

Analysis LevelTechniqueApplication to TMEM143
TranscriptomicRNA-seq, qPCRExpression profiling across tissues and disease states
ProteomicWestern blot, Mass spectrometryProtein level changes and post-translational modifications
FunctionalCRISPR knockout, RNAiPhenotypic effects of TMEM143 modulation
ClinicalPatient sample analysisCorrelation with disease progression or prognosis

Researchers investigating TMEM143 in disease contexts should consider applying the machine learning approaches used for other TMEM genes, including LASSO regression, Support Vector Machine-Recursive Feature Elimination (SVM-RFE), and random forest for survival analysis .

What are the key considerations for designing domain-specific studies of bovine TMEM143?

Understanding TMEM143's domain organization is crucial for targeted functional studies:

Domain Architecture Analysis

  • The DUF3754 domain (Domain of Unknown Function) containing the transmembrane regions

  • The N-terminal mitochondrial targeting sequence (approximately first 52 amino acids)

  • Transmembrane domains (approximately 24 and 16 amino acids in length)

  • Intervening and flanking regions with potential functional significance

Domain-Specific Experimental Approaches

DomainExperimental ApproachExpected Outcome
Mitochondrial Targeting SequenceDeletion/mutation analysisEffects on protein localization
Transmembrane DomainsAlanine scanning mutagenesisIdentification of critical residues for membrane integration
DUF3754Yeast two-hybrid screeningIdentification of interaction partners
Inter-domain RegionsLimited proteolysisDetermination of domain boundaries and flexible regions

Recombinant Domain Expression

For studies requiring individual domains:

  • Express soluble domains separately from transmembrane regions

  • Use fusion partners (MBP, GST) to enhance solubility of hydrophobic segments

  • Consider synthetic peptide approaches for transmembrane domains

  • Validate domain folding using circular dichroism spectroscopy

How should researchers approach cross-species comparative analysis of TMEM143?

Given the limited bovine-specific TMEM143 data, cross-species comparative analysis provides valuable insights:

Sequence Analysis Framework

  • Multiple sequence alignment of TMEM143 across species (human, bovine, mouse, etc.)

  • Identification of conserved motifs and species-specific variations

  • Evolutionary analysis to determine functional constraints on specific regions

  • Prediction of functional impact of species-specific variations

Experimental Comparative Approach

ApproachMethodologyResearch Value
Expression Pattern ComparisonRT-qPCR across matched tissuesIdentification of conserved vs. divergent expression patterns
Functional ComplementationCross-species rescue experimentsAssessment of functional conservation
Interaction Partner AnalysisCo-IP followed by mass spectrometryIdentification of conserved and species-specific interactions
Localization StudiesFluorescent tagging in heterologous systemsVerification of conserved targeting mechanisms

Considerations for Bovine-Specific Research

  • Acknowledge that antibodies raised against human TMEM143 (e.g., AA 8-278) may have variable cross-reactivity with bovine TMEM143

  • Consider the broader reactivity of some antibodies across species (human, cow, dog, etc.) when selecting reagents

  • Account for potential differences in post-translational modifications between species

  • Examine tissue-specific expression patterns that may differ between bovine and human systems

What quality control parameters are essential for recombinant bovine TMEM143 research?

Ensuring reproducible results with recombinant TMEM143 requires rigorous quality control:

Protein Quality Assessment

ParameterMethodAcceptance Criteria
PuritySDS-PAGE, silver staining>90% purity
IdentityWestern blotting, mass spectrometryCorrect molecular weight, peptide coverage
HomogeneitySize exclusion chromatographySingle major peak
Structural IntegrityCircular dichroismExpected secondary structure profile
Functional ActivityBinding assays with known partnersSpecific interaction with expected affinity

Storage and Stability Monitoring

  • Aliquot and store at -20°C or -80°C to minimize freeze-thaw cycles

  • Include 50% glycerol in storage buffer to prevent freeze-thaw damage

  • Protect FITC-conjugated preparations from light exposure

  • Monitor stability through regular quality control testing of stored aliquots

  • Maintain proper preservative concentrations (e.g., 0.03% Proclin-300) for long-term storage

Documentation Requirements

  • Detailed record-keeping of expression conditions

  • Batch-to-batch consistency verification

  • Expiration date assignment based on stability testing

  • Documentation of any modifications (tags, mutations)

  • Certificate of analysis including purity, activity, and contaminant testing

Implementing these quality control measures ensures that experimental variations are attributable to biological effects rather than reagent inconsistencies .

How can researchers effectively design structure-function studies of bovine TMEM143?

Structure-function analyses provide critical insights into TMEM143's molecular mechanisms:

Mutation-Based Approaches

  • Site-directed mutagenesis of conserved residues across species

  • Domain deletion/truncation constructs to identify functional regions

  • Chimeric proteins swapping domains between TMEM family members

  • Introduction of post-translational modification site mutations

Functional Readouts for Mutational Analysis

FunctionAssay MethodExpected Impact of Mutations
Mitochondrial LocalizationFluorescence microscopyMislocalization of targeting sequence mutants
Membrane IntegrationAlkaline extraction assayReduced membrane association of TM domain mutants
Protein-Protein InteractionsCo-IP, FRETDisruption of specific interactions
Protein StabilityCycloheximide chaseAltered protein half-life

Computational Structure Prediction

Due to limited structural data on TMEM143:

  • Utilize homology modeling based on structurally characterized membrane proteins

  • Perform molecular dynamics simulations to predict transmembrane domain stability

  • Use co-evolutionary analysis to identify functionally coupled residues

  • Implement secondary structure prediction algorithms for domain boundary identification

These approaches provide complementary insights into TMEM143 function while accounting for the challenges of direct structural determination of membrane proteins.

What challenges should researchers anticipate when studying TMEM143 in primary bovine cells?

Working with TMEM143 in primary bovine cells presents unique challenges that require specialized approaches:

Isolation and Culture Considerations

  • Tissue selection based on predicted high expression (skeletal muscle, heart)

  • Optimized isolation protocols to maintain mitochondrial integrity

  • Culture conditions that preserve physiological TMEM143 expression levels

  • Avoidance of cell passage-induced expression changes

Genetic Manipulation Strategies

ApproachAdvantagesLimitations
siRNA/shRNATransient knockdown, easy deliveryIncomplete silencing, off-target effects
CRISPR/Cas9Complete knockout, specificityChallenging delivery to primary cells
Adenoviral OverexpressionHigh efficiency, controlled timingPotential toxicity, size limitations
Lentiviral IntegrationStable expressionRandom integration effects

Specialized Analysis Techniques

  • Live-cell imaging of mitochondrial dynamics in primary cells

  • Respirometry on isolated mitochondria from manipulated cells

  • Seahorse XF analysis for metabolic profiling

  • Single-cell approaches to account for cellular heterogeneity

How can immunological techniques be optimized for TMEM143 detection in bovine tissues?

Optimizing immunological detection of TMEM143 in bovine tissues requires careful method development:

Antibody Selection Criteria

  • Epitope location relative to TMEM143 domains (N-terminal, C-terminal, or internal regions)

  • Clonality (polyclonal antibodies provide broader epitope recognition)

  • Confirmed cross-reactivity with bovine TMEM143

  • Application-specific validation (Western blot, IHC, IF, ELISA)

Tissue Preparation Optimization

TechniqueCritical ParametersOptimization Approach
Western BlottingExtraction buffer, detergent typeTest multiple lysis conditions for membrane protein extraction
ImmunohistochemistryFixation method, antigen retrievalCompare fixatives, optimize retrieval temperature/time
ImmunofluorescencePermeabilization, blockingTest detergent concentrations, extend blocking time
Flow CytometryCell preparation, antibody concentrationTitrate antibody, optimize permeabilization

Signal Enhancement Strategies

  • Use of conjugated secondary antibodies (FITC, HRP, Biotin) for different detection methods

  • Amplification systems for low-abundance detection (tyramide signal amplification)

  • Multi-epitope detection strategies using antibodies targeting different regions

  • Background reduction through extended washing and optimized blocking

These optimizations are particularly important for mitochondrial membrane proteins like TMEM143, which may be present at relatively low abundance and require careful sample preparation to maintain epitope accessibility.

What bioinformatic approaches are most valuable for bovine TMEM143 characterization?

Bioinformatic analysis provides essential insights for experimental design and interpretation:

Sequence-Based Analysis

  • Identification of bovine TMEM143 orthologs and paralogs

  • Prediction of functional domains, motifs, and post-translational modifications

  • Transmembrane topology prediction using multiple algorithms

  • Identification of conserved residues through multiple sequence alignment

Structural Prediction Tools

Analysis TypeToolsApplication to TMEM143
Secondary StructurePSIPRED, JPredPrediction of α-helical transmembrane domains
Tertiary StructureAlphaFold, RoseTTAFoldModel generation for soluble domains
Protein-Protein InteractionsSTRING, BIOGRIDPrediction of interaction partners
Post-translational ModificationsNetPhos, NetOGlycIdentification of potential regulatory sites

Expression Data Mining

  • Analysis of bovine transcriptomic datasets across tissues

  • Comparative expression analysis with human and mouse data

  • Co-expression network analysis to identify functionally related genes

  • Expression correlation with mitochondrial genes across tissues

These computational approaches generate testable hypotheses and help prioritize experimental directions, particularly valuable for less-characterized proteins like bovine TMEM143.

How should researchers interpret contradictory findings when studying TMEM143 function?

Navigating contradictory results is a common challenge in researching poorly characterized proteins like TMEM143:

Systematic Reconciliation Approach

  • Evaluate methodological differences between studies (cell types, expression systems, tags)

  • Consider isoform-specific effects (TMEM143 has multiple transcript variants)

  • Assess species-specific differences that may explain discrepancies

  • Examine cellular context dependencies (cell type, metabolic state, stress conditions)

Resolution Strategies for Common Contradictions

Contradiction TypeInvestigation ApproachExamples for TMEM143
Localization DiscrepanciesMultiple tagging strategies, endogenous vs. overexpressionMitochondrial vs. other membrane localization
Functional EffectsAcute vs. chronic depletion, partial vs. complete knockoutDifferent phenotypes in knockdown vs. knockout
Interaction PartnersMultiple interaction detection methodsDifferent partners identified by Y2H vs. co-IP
Expression PatternsMultiple detection methods, tissue preparation differencesVariability in tissue expression profiles

Integration Framework

  • Develop testable models that accommodate seemingly contradictory observations

  • Design critical experiments specifically addressing the source of contradictions

  • Consider context-dependent functions as an explanation for divergent findings

  • Acknowledge limitations of each experimental approach when interpreting results

The emerging nature of TMEM143 research makes contradictory findings particularly likely, requiring researchers to maintain methodological rigor and careful interpretation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.