Recombinant Bovine Transmembrane protein 160 (TMEM160)

Shipped with Ice Packs
In Stock

Description

Expression Systems

SystemAdvantagesLimitations
E. coliHigh yield, cost-effective, rapid productionMay lack post-translational modifications
Mammalian cellsProper folding, glycosylation, and subcellular localizationHigher cost, longer production time

Functional Validation

  • CHX Half-Life Assays: TMEM160 stabilizes PD-L1 by competing with SPOP for ubiquitination, extending PD-L1’s half-life in CRC cells .

  • MG132 Rescue Experiments: Proteasome inhibition restores PD-L1 levels in TMEM160-deficient cells, confirming its role in protein degradation .

  • Immunofluorescence: TMEM160 localizes to mitochondria and nuclei, with dynamic redistribution during mitosis .

Role in Tumor Biology

FunctionMechanismDisease Model
PD-L1 StabilizationBinds PD-L1, preventing SPOP-mediated degradation; enhances immune evasionCRC
RadioresistanceMitigates radiation-induced DNA damage via mitochondrial ROS modulationCRC
Cell Cycle RegulationInteracts with nucleoporins (NUP50) and importins (KPNA6) to regulate DNA replicationLUAD

Clinical Relevance

ObservationClinical Implication
High TMEM160 ExpressionCorrelates with advanced CRC stages and poor prognosis
PD-L1 Co-ExpressionStrong positive correlation in CRC; predicts resistance to immunotherapy

Applications in Research

ApplicationPurpose
Antibody ValidationServes as a positive control for anti-TMEM160 antibodies in ELISA/WB
Cell CultureStudies mitochondrial function, PD-L1 regulation, and tumor cell proliferation
Drug DiscoveryScreens for inhibitors targeting TMEM160-PD-L1 interactions

Challenges and Future Directions

  • Functional Heterogeneity: TMEM160’s dynamic localization (mitochondria vs. nucleus) complicates mechanistic studies .

  • Species-Specific Variations: Differences in TMEM160’s role between bovine and human models require cross-species validation .

  • Therapeutic Targeting: Inhibiting TMEM160 could enhance PD-L1 degradation, but off-target effects on mitochondrial function must be mitigated .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If a specific tag type is required, please inform us, and we will prioritize its incorporation.
Synonyms
TMEM160; Transmembrane protein 160
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM160
Target Protein Sequence
MGGGWWWARAARLARLRFRGALLPPPRPRSGGARGSFAPGHGPRAGASPPPVSELDRADA WLLRKAHETAFLSWFRNGLLASGIGVISFMQSDMGREAAYGFFLLGGLCVVWGGASYVVG LAALRGPMQLSVGGAAAGVGAVLAAGLLWACAVGLYMGQLELDVELVPEDDGTTAAEGPD EAGRPPPE
Uniprot No.

Target Background

Database Links

KEGG: bta:508953

STRING: 9913.ENSBTAP00000020695

UniGene: Bt.9171

Protein Families
TMEM160 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What expression systems and purification methods are most effective for producing functional Recombinant Bovine TMEM160?

For recombinant bovine TMEM160 production, E. coli expression systems have been successfully employed with the following methodological considerations:

  • Expression System: E. coli with N-terminal His-tagging has proven effective for full-length TMEM160 (1-188aa) expression .

  • Purification Strategy: IMAC (Immobilized Metal Affinity Chromatography) purification followed by buffer exchange into Tris/PBS-based buffer with 6% Trehalose at pH 8.0 maintains protein stability .

  • Storage Conditions: Lyophilization and storage at -20°C/-80°C with aliquoting to avoid repeated freeze-thaw cycles .

  • Reconstitution Protocol: Brief centrifugation prior to opening, followed by reconstitution in deionized sterile water to 0.1-1.0 mg/mL with 5-50% glycerol for long-term stability .

Researchers should verify protein purity via SDS-PAGE (>90% purity is achievable) and confirm functionality through appropriate activity assays relevant to the research question .

What is the confirmed subcellular localization of TMEM160, and how might this influence experimental design when studying bovine systems?

Recent studies have conclusively demonstrated that TMEM160 is localized to the mitochondrial inner membrane, requiring special consideration in bovine cellular studies:

  • Localization Verification: Co-localization with mitochondrial markers (e.g., Mito Tracker Red) shows TMEM160 is predominantly mitochondrial .

  • Membrane Association: TMEM160 is an alkali-resistant protein, indicating it is an integral membrane protein rather than peripherally associated .

  • Experimental Implications: Studies on bovine TMEM160 should include:

    • Mitochondrial isolation protocols when purifying native protein

    • Mitochondrial function assays when studying phenotypic effects

    • Co-immunoprecipitation studies with other mitochondrial proteins to understand interaction networks

When designing experiments, researchers should account for potential dual localization, as some studies have observed TMEM160 in both nuclear and cytoplasmic compartments in cancer cells, suggesting context-dependent localization that may also exist in bovine systems .

How does TMEM160 depletion affect mitochondrial function and cellular responses in mammalian cells, and what implications might this have for bovine studies?

TMEM160 depletion triggers significant mitochondrial stress responses with potential relevance to bovine cellular physiology:

  • UPRmt Activation: TMEM160 knockdown upregulates the mitochondrial chaperone HSPD1 and transcription factors (ATF4, ATF5, DDIT3) that induce the mitochondrial unfolded protein response .

  • Protein Import Modification: Enhanced expression of mitochondrial protein import receptors TOMM22 and TOMM20 follows TMEM160 depletion .

  • Oxidative Stress: Significant increase in reactive oxygen species (ROS) generation and upregulation of glutathione S-transferases for detoxifying oxidative stress products .

  • Stress Response Persistence: UPRmt markers remain elevated even after ROS is scavenged with N-acetylcysteine, suggesting TMEM160 has direct roles in mitochondrial protein stabilization independent of ROS regulation .

For bovine researchers, these findings suggest TMEM160 may be critical for mitochondrial homeostasis in energy-demanding bovine tissues such as muscle and mammary gland, with potential implications for productivity traits.

What experimental controls are essential when studying recombinant Bovine TMEM160 in functional assays?

When designing experiments with recombinant Bovine TMEM160, implement these critical controls:

  • Expression Vector Control: Include cells transfected with empty vector (e.g., pCMV6-Entry) to distinguish effects of TMEM160 expression from vector-related artifacts .

  • Non-targeting siRNA Controls: When performing knockdown studies, universal negative control siRNAs with comparable GC content but no homology to bovine sequences are essential (e.g., sense: 5′-UUCUCCGAACGUGUCACGUdTdT-3′, antisense: 5′-ACGUGACACGUUCGGAGAAdTdT-3′) .

  • Rescue Experiments: To confirm phenotype specificity, include conditions where wild-type TMEM160 is re-expressed in knockdown cells.

  • Protein Modification Controls: For studies examining post-translational modifications, include conditions with inhibitors of relevant pathways (e.g., MG132 for proteasome inhibition) .

Additionally, time-course experiments are necessary to distinguish between acute and chronic effects of TMEM160 manipulation, as demonstrated in studies where UPRmt activation persisted independently of ROS levels .

What methodological approaches best elucidate the interaction partners of Bovine TMEM160?

To comprehensively identify TMEM160 interactors in bovine systems, consider this multi-faceted approach:

  • Co-Immunoprecipitation Protocol:

    • Culture cells to 80-90% confluence

    • Lyse with NP40 buffer containing 0.5% CHAPS and protease/phosphatase inhibitors

    • Incubate with gentle shaking (1h, 4°C)

    • Centrifuge (13,500 rpm, 25min, 4°C)

    • Pre-incubate protein A/G agarose beads with anti-TMEM160 antibody (1h, 4°C)

    • Stabilize interaction with BS3 crosslinker

    • Quench with Tris-HCl (pH 7.5)

    • Wash thoroughly to remove non-specific binding

    • Elute with acidic glycine buffer (pH 2.5) and neutralize with Tris base

  • Validation Approaches:

    • Reciprocal Co-IP using antibodies against identified partners

    • Proximity ligation assays to confirm interactions in situ

    • GST pull-down assays with recombinant proteins to validate direct interactions

    • Molecular docking analysis using 3D structure predictions to assess binding potential

Recent studies have revealed interactions between TMEM160 and nuclear proteins like NUP50 in other species, suggesting potential novel functions beyond mitochondria that warrant investigation in bovine systems .

Given TMEM160's role in oxidative stress, how might it influence bovine cellular responses to environmental challenges relevant to livestock production?

TMEM160's involvement in ROS regulation has significant implications for bovine adaptation to production stressors:

  • Heat Stress Response: In temperature-humidity index (THI) challenged conditions (comparable to the THI of 54.0 ± 4.0 reported in cattle housing facilities), TMEM160 may mediate mitochondrial adaptations to heat stress .

  • Metabolic Challenges: During transitions like the periparturient period in dairy cattle, TMEM160 could influence mitochondrial responses to negative energy balance, as suggested by its role in glycolysis pathways identified in interactome studies .

  • Feedlot Adaptation: High-concentrate diets increase oxidative stress in bovine tissues; TMEM160's role in ROS regulation may influence adaptation to intensive feeding systems.

Research methodology should include:

  • Expression analysis of TMEM160 across physiological states (e.g., pre/post-calving)

  • Integration with markers of oxidative stress and mitochondrial function

  • Correlation with production parameters to identify potential applications

This approach could reveal whether TMEM160 expression or polymorphisms correlate with resilience to production challenges.

What potential exists for TMEM160 in understanding or addressing reproductive challenges in bovine systems?

While direct evidence for TMEM160's role in bovine reproduction is limited, related findings suggest research potential:

  • Male Reproduction: Studies of the related protein TMEM95 demonstrate its exclusive expression in bovine testes and brain, with significant implications for male reproductive performance . Similar tissue-specific expression patterns could exist for TMEM160.

  • Cellular Energy Demands: The mitochondrial location of TMEM160 positions it at the center of cellular energy production, critical for energy-intensive reproductive processes.

  • Oxidative Stress Balance: Reproductive tissues are particularly vulnerable to oxidative damage; TMEM160's role in ROS regulation may be relevant to gamete quality and early embryonic development.

Recommended research approaches include:

  • Tissue-specific expression profiling of TMEM160 in bovine reproductive organs

  • Functional studies in gamete and embryo culture systems

  • Association studies with fertility metrics in breeding populations

Such studies may reveal whether TMEM160 variants contribute to unexplained fertility variation in cattle populations.

How do findings about TMEM160 function in human disease models inform bovine agricultural research applications?

Recent discoveries about TMEM160 in human disease models offer valuable insights for bovine research:

  • Oncogenic Properties: TMEM160 promotes tumor growth in human lung adenocarcinoma and cervical cancer through:

    • Enhanced cell proliferation (demonstrated via MTT assay showing significant reduction after TMEM160 knockout)

    • Increased cellular migration (shown in wound closure assays)

    • Tumor growth promotion (xenograft studies showed significantly smaller tumors with TMEM160 knockdown)

  • Immune Regulation: TMEM160 stabilizes PD-L1 expression by inhibiting ubiquitination-dependent degradation, which promotes immune evasion .

These findings suggest potential roles in bovine immune regulation and cell proliferation that could be relevant to:

  • Mammary gland development and involution

  • Immune responses to bovine pathogens

  • Tissue repair following injury or infection

Research approaches should include comparative expression analysis in bovine tissues under normal and pathological conditions, with particular attention to immune and proliferative contexts.

What structural and functional differences exist between bovine and human TMEM160 that may influence experimental design and translational applications?

Understanding structural differences between bovine and human TMEM160 is crucial for experimental design:

  • Size and Structure: Both human and bovine TMEM160 are 188 amino acids, but with species-specific variations that may affect:

    • Protein-protein interactions

    • Post-translational modifications

    • Subcellular trafficking

  • Species-Specific Interactions: The TMEM160 interactome identified in human cells includes pathways involved in:

    • Apical junctions

    • Xenobiotic metabolism

    • Glycolysis

    • Epithelial-mesenchymal transition

    • Reactive oxygen species pathways

    • UV response DNA

    • P53 pathway

    • Mitotic spindle

For robust translational research, experimental designs should:

  • Include species-specific antibodies and validation steps

  • Verify interacting partners in bovine systems rather than assuming conservation

  • Consider testing both bovine and human TMEM160 in parallel to identify divergent functions

This comparative approach will strengthen both basic research understanding and potential biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.