Recombinant Bovine Transmembrane protein 176A (TMEM176A)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant bovine TMEM176A is typically produced via heterologous expression:

  • Expression Systems: Optimized for E. coli due to cost efficiency, but mammalian systems (e.g., HEK293) preserve post-translational modifications .

  • Purification: Affinity chromatography using His-tag followed by size-exclusion chromatography .

  • Storage: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) at -20°C/-80°C .

Ion Channel Activity

  • Regulates cation transport (Na+/K+) in dendritic cells, influencing antigen presentation and immune tolerance .

  • Modulates endolysosomal acidification, critical for MHC class II antigen processing .

Cancer Biology

  • Acts as an oncogene in non-small cell lung cancer (NSCLC) by promoting cell proliferation via CDK4/Cyclin D1 pathways .

  • Hypermethylation of its promoter correlates with reduced expression in lung adenocarcinoma, suggesting tumor-suppressive potential in specific contexts .

Signaling Pathways

  • Inhibits ERK and AKT/mTOR signaling in breast cancer, affecting tumor growth and metastasis .

Applications in Research

Recombinant bovine TMEM176A is utilized in:

  • Structural Studies: Mapping ion channel topology using cryo-EM or X-ray crystallography .

  • Drug Discovery: Screening for inhibitors targeting TMEM176A/B in autoimmune diseases or cancer .

  • Immune Function Assays: Studying dendritic cell maturation and T-cell priming mechanisms .

Challenges and Future Directions

  • Species-Specific Variability: Functional differences between bovine and human isoforms require careful interpretation .

  • Therapeutic Targeting: Conflicting roles in cancer (oncogene vs. tumor suppressor) necessitate context-specific studies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
TMEM176A; CL1; Transmembrane protein 176A; Corpus luteum protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-241
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM176A
Target Protein Sequence
METVDCGEAAPRAPQPASIQVHFHHESGLAKLLLGGCSLLQPLLLPRPRATSRALGRHRL LATSWVMQIVLGLLSGVLGGFLYIFSSTTLRNSGAPIWTGAVAVLAGAVAFIYEKRGGIY WALLRTLLALAAFSTATAATIIGAGRFYEYHFIFYKGICNVSPSWRPTGAPTLSPDLERL QQCTAYVNMLKALFISINAMLLGVWVLLLLASLLPLCLCCWRRYRRKEKRDLPLEETVRS E
Uniprot No.

Target Background

Database Links
Protein Families
TMEM176 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM176A and what is its basic structure?

TMEM176A is a transmembrane protein that belongs to the CD20-like MS4A family of proteins . The bovine TMEM176A protein consists of 241 amino acids with multiple transmembrane domains. Its full amino acid sequence is: METVDCGEAAPRAPQPASIQVHFHHESGLAKLLLGGCSLLQPLLLPRPRATSRALGRHRLLATSWVMQIVLGLLSGVLGGFLYIFSSTTLRNSGAPIWTGAVAVLAGAVAFIYEKRGGIYWA LLRTLLALAAFSTATAATIIGAGRFYEYHFIFYKGICNVSPSWRPTGAPTLSPDLERLQQCTAYVNMLKALFISINAMLLGVWVLLLLASLLPLCLCCWRRYRRKEKRDLPLEETVRS E . The protein structure suggests it spans the membrane multiple times, which is consistent with its potential role in forming ion channels.

How does TMEM176A function at the cellular level?

TMEM176A and its homologous protein TMEM176B can physically associate to form heteromeric and homomeric multimers . Recent studies in rodent immune cells have demonstrated that these multimers can form functional ion channels near the trans-Golgi Network (TGN) . In this location, they may influence intracellular signaling events that ultimately regulate immune functions. The protein appears to be involved in dendritic cell maturation and activation, with abnormal accumulations potentially restraining these processes . This suggests TMEM176A plays a regulatory role in immune cell function.

What are the recommended methods for expressing and purifying recombinant TMEM176A?

Recombinant TMEM176A can be produced using bacterial expression systems such as E. coli. For purification, His-tagging is commonly employed to facilitate affinity chromatography . The expressed protein can be obtained in a lyophilized powder form, which requires proper reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, it is recommended to add 5-50% glycerol (with 50% being standard) and aliquot for storage at -20°C/-80°C . Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .

What analytical techniques are most effective for studying TMEM176A expression and interactions?

Multiple analytical techniques have proven effective for TMEM176A research:

  • Quantitative PCR: For measuring TMEM176A mRNA expression levels, qPCR with appropriate reference genes (e.g., 18S rRNA) has been successfully employed .

  • Co-immunoprecipitation (co-IP): To study protein-protein interactions involving TMEM176A, co-IP followed by liquid chromatography-mass spectrometry (LC-MS/MS) has been effective in identifying binding partners .

  • SDS-PAGE: For assessing protein purity and molecular weight .

  • Immunohistochemistry and Fluorometric Detection: These techniques have been utilized to quantify TMEM176A protein levels in tissue samples using specific antibodies conjugated with fluorescent markers like IRDye 800CW .

How does TMEM176A influence immune cell regulation?

TMEM176A appears to play a critical role in immune cell regulation, particularly in dendritic cell function. Research suggests that abnormal accumulations of TMEM176A/B multimers can restrain dendritic cell maturation and activation . TMEM176A and TMEM176B may serve as potential targets for immune cell regulation due to their ability to form ion channels that influence intracellular signaling events . The precise mechanisms through which TMEM176A modulates immune responses are still being elucidated, but evidence indicates its involvement in maintaining immune tolerance.

What is the relationship between TMEM176A and antitumor immunity?

TMEM176A, along with TMEM176B, appears to be involved in the evasion of immune surveillance by cancer cells . Studies have shown that disruption of TMEM176B expression enhances antitumor immunity, suggesting a similar role for TMEM176A given their functional similarity and ability to form heteromeric complexes . Research in mouse models has demonstrated that targeting these proteins may increase effector T cell/regulatory T cell ratios in tumor environments and enhance CD8+ T cell responses against tumor antigens .

What cancer types show altered TMEM176A expression?

Research has identified significant alterations in TMEM176A expression across multiple cancer types:

  • Lymphoma: Human TMEM176A protein levels are significantly elevated in lymphoma compared to normal tissues .

  • Hepatocellular Carcinoma (HCC): TMEM176A is frequently silenced in HCC through promoter region hypermethylation .

Other cancer types have been studied, including breast, colon, lung, kidney, ovarian, endometrial, stomach, prostate, melanoma, and liver cancers, though the specific patterns of TMEM176A expression in these cancers require further investigation .

How does TMEM176A function as a tumor suppressor in hepatocellular carcinoma?

In HCC, TMEM176A appears to function as a tumor suppressor. Research shows that:

  • TMEM176A suppresses HCC cell growth both in vitro and in vivo .

  • The mechanism involves inhibition of the ERK signaling pathway through interaction with SAR1A .

  • Experimental evidence from xenograft mouse models confirms that re-expression of TMEM176A in HCC cells significantly reduces tumor volume and weight .

  • TMEM176A expression is regulated by promoter region methylation, with hypermethylation leading to silencing of TMEM176A in HCC cells .

This suggests that loss of TMEM176A expression through epigenetic silencing may contribute to HCC tumorigenesis by allowing activation of the ERK signaling pathway.

What mechanisms control TMEM176A expression?

TMEM176A expression is primarily regulated through epigenetic mechanisms, particularly DNA methylation of its promoter region. In HCC, the TMEM176A promoter is frequently methylated, which correlates with reduced or absent expression of the gene . Treatment with the DNA methylation inhibitor 5-Aza-2-deoxycytidine can restore TMEM176A expression in cells where it is silenced by promoter methylation, confirming that methylation directly regulates its expression .

What are effective strategies for disrupting TMEM176A expression?

Two main approaches have been successfully employed to disrupt TMEM176A expression:

  • RNA Interference (RNAi): Although this approach has been attempted, it has not consistently produced significant or reproducible knockdown of TMEM176A expression in all cell types, such as HEK293T cells .

  • CRISPR/Cas9 Gene Editing: This has proven more effective for creating stable TMEM176A knockdown cell lines. Successfully designed guide RNAs targeting specific regions of TMEM176A (e.g., pX459-TMEM176A gRNA1) have conferred mutations in the targeted regions and established stable knockdown cell lines .

For researchers seeking to manipulate TMEM176A expression, CRISPR/Cas9 appears to be the more reliable and efficient method compared to RNAi-based approaches.

What considerations should be made when designing CRISPR/Cas9 experiments for TMEM176A?

When designing CRISPR/Cas9 experiments to target TMEM176A, researchers should consider:

  • Guide RNA Selection: Careful design of guide RNAs targeting critical functional domains of TMEM176A is essential for efficient knockdown.

  • Off-target Effects: Potential off-target effects should be minimized through careful guide RNA design and appropriate controls.

  • Verification Methods: Successful gene editing should be verified through sequencing to confirm mutations in the targeted regions.

  • Functional Validation: Phenotypic changes resulting from TMEM176A disruption should be thoroughly assessed to confirm the functional consequences of the genetic manipulation.

What are the functional similarities and differences between TMEM176A and TMEM176B?

TMEM176A and TMEM176B share several key characteristics:

  • Structural Similarity: They have high sequence homology and similar protein structures .

  • Complex Formation: They can physically associate to form heteromeric and homomeric multimers, which may function as ion channels .

  • Cellular Localization: Both are found near the trans-Golgi Network .

  • Immune Function: Both proteins appear to play roles in immune cell function, particularly in dendritic cell maturation and activation .

Despite these similarities, they may have distinct roles in different cellular contexts or tissues, and their individual contributions to complex formation and channel function may differ. Research suggests they work together in many contexts, but further studies are needed to fully elucidate their specific individual functions.

How should researchers approach studying the combined effects of TMEM176A and TMEM176B?

Given their functional relationship, researchers should consider:

  • Double Knockdown/Knockout Studies: Creating cell lines or animal models with disruption of both TMEM176A and TMEM176B to assess potential redundant or synergistic functions.

  • Protein-Protein Interaction Analysis: Detailed study of how these proteins interact, including identification of critical interaction domains and how these interactions influence their functions.

  • Comparative Expression Analysis: Systematic comparison of expression patterns across tissues and disease states to identify contexts where their expression diverges.

  • Rescue Experiments: Testing whether expression of one protein can rescue phenotypes caused by loss of the other to assess functional redundancy.

How does bovine TMEM176A compare to human and mouse orthologs?

Bovine TMEM176A shares significant homology with human and mouse orthologs, making it a valuable model for comparative studies. The full-length bovine TMEM176A consists of 241 amino acids , while comparative analysis of amino acid sequences across species reveals conservation of key functional domains. This conservation suggests similar core functions across species, though species-specific differences in regulation and interaction partners may exist. Researchers should be aware of these potential differences when extrapolating findings from bovine studies to human applications.

What are the implications of using recombinant bovine TMEM176A in translational research?

When using recombinant bovine TMEM176A for research with translational goals:

How can TMEM176A be targeted for therapeutic purposes?

Potential therapeutic strategies targeting TMEM176A include:

  • Demethylating Agents: In cancers where TMEM176A is silenced by promoter methylation, such as HCC, demethylating agents may restore expression and tumor-suppressive functions .

  • Ion Channel Modulators: Given TMEM176A's potential role in forming ion channels, compounds that specifically modulate its channel activity could be developed to influence immune responses or cancer growth.

  • Protein-Protein Interaction Inhibitors: Molecules that disrupt interactions between TMEM176A and key partners (such as SAR1A in HCC) could potentially modulate its effects on signaling pathways like ERK .

  • Gene Therapy Approaches: For cancers with reduced TMEM176A expression, gene therapy strategies to restore expression might have therapeutic potential.

What are the current limitations in TMEM176A research and future directions?

Current research limitations and future directions include:

  • Structural Understanding: Detailed structural information about TMEM176A, particularly its configuration as an ion channel, remains limited. Advanced structural biology techniques like cryo-EM could help elucidate its structure.

  • Tissue-Specific Functions: More comprehensive understanding of TMEM176A's functions across different tissues and cell types is needed.

  • Signaling Mechanisms: While some pathways (like ERK signaling) have been implicated, the complete signaling networks influenced by TMEM176A require further elucidation.

  • Clinical Relevance: Larger clinical studies are needed to validate TMEM176A's role as a biomarker or therapeutic target across different cancer types.

  • Technological Innovations: Development of specific antibodies, small molecule modulators, and improved gene editing approaches would facilitate more sophisticated TMEM176A research.

What are common challenges in working with recombinant TMEM176A?

Researchers frequently encounter several challenges when working with recombinant TMEM176A:

  • Protein Solubility: As a transmembrane protein, TMEM176A can present solubility challenges. Proper reconstitution in appropriate buffers is critical .

  • Stability Issues: The protein may degrade with repeated freeze-thaw cycles. Aliquoting and proper storage at -20°C/-80°C with glycerol is recommended .

  • Functional Assays: Developing reliable assays for TMEM176A function, particularly for its ion channel activity, can be technically challenging.

  • Antibody Specificity: Ensuring antibody specificity for TMEM176A versus the highly homologous TMEM176B requires careful validation.

How can researchers optimize expression systems for TMEM176A studies?

For optimal expression of recombinant TMEM176A:

  • Expression System Selection: While E. coli has been successfully used , mammalian expression systems may provide better post-translational modifications for functional studies.

  • Codon Optimization: Adapting the coding sequence to the preferred codons of the expression host can improve yield.

  • Tags and Fusion Partners: Strategic placement of affinity tags (e.g., His-tag) and use of solubility-enhancing fusion partners can improve both expression and purification outcomes .

  • Purification Strategy: Development of a multi-step purification protocol specific to TMEM176A, potentially including affinity chromatography followed by size exclusion or ion exchange chromatography, may improve protein purity and yield.

  • Storage Buffer Optimization: The composition of storage buffers (including pH, salt concentration, and stabilizing agents) should be empirically optimized for TMEM176A stability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.