Recombinant Bovine Transmembrane protein 182 (TMEM182)
Shipped with Ice Packs 
In Stock 
Description
Definition and Production Characteristics
Recombinant Bovine TMEM182 is a synthetic version of the native TMEM182 protein, expressed in Escherichia coli or mammalian cells (e.g., HEK293) with engineered tags for purification. Key production features include:
The protein spans 229 amino acids (full-length) or partial sequences (e.g., residues 27–229) .
Functional Roles in Muscle Biology
TMEM182 acts as a negative regulator of myogenic differentiation and muscle growth:
Key Experimental Models:
-
In Vitro: Chicken/mouse primary myoblasts show impaired differentiation with TMEM182 overexpression .
-
In Vivo: TMEM182-KO mice exhibit enhanced skeletal muscle mass and accelerated regeneration post-injury .
Research Applications and Challenges
Comparative Analysis of TMEM182 with Related Proteins
Product Specs
Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped on blue ice unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Note: All proteins are shipped on blue ice unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Note: While the tag type is determined during production, please inform us of any specific tag requirements; we will prioritize fulfilling such requests.
Note: While the tag type is determined during production, please inform us of any specific tag requirements; we will prioritize fulfilling such requests.
Synonyms
TMEM182; Transmembrane protein 182
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-229
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
TMEM182
Target Protein Sequence
SDYWLLATEVAKCSGEQNIENVTFHHEGFFWRCWFNGIVEENDSNIWQFWYTNQPLWKNC
THAYLSPYPFLRGEHNSTSYDSAVIYRGFWAVLMLLGVVAVVTASFLIICAAPFTSHLLY
KAGGGAYIAAGVLFALVVMLYVIWVQAVADLESYRHRKMRDCLDFSPSVLYGWSFFLAPA
GIFFSLLAGLLFLIVGRHIQIHH
Uniprot No.
Target Background
Database Links
Protein Families
TMEM182 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
