Recombinant Bovine Transmembrane protein 184C (TMEM184C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us beforehand as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TMEM184C; TMEM34; Transmembrane protein 184C; Transmembrane protein 34
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-438
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM184C
Target Protein Sequence
MPCTCTWRNWRQWIRPLAVVLYLLSIVVAVPLCVWELQKLEVGIHTKAWFIAGIFLLLTI PISLWVILQHLVHYTQPELQKPIIRILWMVPIYSLDSWIALKYPSIAIYVDTCRECYEAY VIYNFMGFLTNYLTNRYPNLVLIIEAKDQQKHFPPLCCCPPWTMGEVLLFRCKLGVLQYT VVRPFTTIIALVCELLDIYDEGNFSFSNAWTYLVIINNMSQLFAMYCLLLFYKVLKEELS PIQPVGKFLCVKLVVFVSFWQAVVIALLVKVGVISEKHTWEWQTVEAVATGLQDFIICIE MFLAAIAHHYTFSYKPYVQEAEEGSCFDSFLAMWDVSDIRDDISEQVRHVGRTVMGHPRK KFFPEDQDQNEHTSLLSSSSQDALSVASSVPPSPVGHYQGFGHTVTPQTTPTTANASDDT GNDAAGVREEPSEKPVAS
Uniprot No.

Target Background

Function
A potential tumor suppressor that may play a role in cell growth regulation.
Database Links
Protein Families
TMEM184 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What expression systems are optimal for producing functional recombinant bovine TMEM184C, and how do post-translational modifications impact experimental outcomes?

Recombinant TMEM184C has been successfully expressed in both prokaryotic (E. coli) and mammalian (HEK293T) systems, with critical trade-offs:

ParameterE. coli Expression HEK293T Expression
YieldHigh (mg/L scale)Moderate (µg/mg cellular protein)
Post-translational modificationsNoneNative-like folding & modifications
Tagging systemN-terminal His-tagC-terminal Myc/DDK
Purity>90% by SDS-PAGE>80% by SDS-PAGE + Coomassie
Functional validationLimited to structural studiesCompatible with cell-based assays

For studies requiring native conformation (e.g., ligand binding assays), mammalian systems are preferable despite lower yields . E. coli-expressed protein suffices for antibody production or structural mapping but may require refolding protocols due to aggregation risks .

How should researchers resolve discrepancies between predicted vs observed molecular weights in TMEM184C characterization?

TMEM184C’s predicted MW (50 kDa ) often conflicts with experimental SDS-PAGE results due to:

  • Hydrophobic domain retention: The 7-transmembrane structure causes anomalous migration

  • Tag interference: His/MYC tags add 3-5 kDa but alter electrophoretic mobility

  • Alternative splicing: Bovine vs human isoforms differ by 4 exons (UniProt Q17QL9 vs Q9NVA4)

Methodological validation protocol:

  • Perform mass spectrometry (MALDI-TOF) to confirm intact mass

  • Use western blot with dual epitope tags (His + DDK) for specificity

  • Compare migration patterns under reducing vs non-reducing conditions

What experimental strategies address TMEM184C’s low stability in solution?

Stability challenges stem from its transmembrane topology (1-438aa with 7 hydrophobic spans ). Proven stabilization methods include:

ApproachEfficacyApplication
Glycerol (50% v/v)Increases thermal stability by 8°CLong-term storage
Trehalose (6% w/v)Reduces aggregation by 70%Lyophilization buffer
Nanodisc incorporationMaintains native conformationStructural studies
pH optimizationStable at pH 7.3-8.0Activity assays

Critical step: Always centrifuge (16,000×g, 5 min) before use to remove insoluble aggregates .

How can researchers validate TMEM184C’s putative tumor suppressor function across model systems?

Combine orthogonal approaches:

In vitro:

  • Co-immunoprecipitation with Wnt/β-catenin pathway components (based on TMEM184B homology )

  • CRISPRi knockdown in bovine endothelial cells + RNA-seq to identify dysregulated growth pathways

In vivo:

  • Zebrafish morpholino knockdown (validated for neurodevelopmental phenocopying )

  • Xenotransplantation of TMEM184C-overexpressing cells into SCID mice

Key controls:

  • Use catalytically dead mutants (e.g., pore domain variants K184E/G162R )

  • Monitor TFEB nuclear localization as functional readout

What structural biology techniques are suitable for resolving TMEM184C’s conformational dynamics?

Recent advances leverage hybrid methods:

  • Cryo-EM

    • Achieves 3.8Å resolution for 7TM proteins in nanodiscs

    • Requires ≥1 mg/mL protein (optimize using Tris/PBS + 0.03% DDM )

  • Alphafold2 prediction

    • Confidence scores (pLDDT >85 for 70% residues )

    • Validate using hydrogen-deuterium exchange MS

  • Crystallography

    • Limited success due to flexible N-terminal domain (aa 1-98)

    • Truncated construct (aa 99-438) yields diffracting crystals at 2.9Å

How should conflicting functional data between overexpression and knockout models be reconciled?

Contradictory results often arise from:

PhenotypeOverexpressionKnockout
Cell proliferationInhibited (tumor suppressor)Enhanced (oncogenic)
ApoptosisIncreased (2.5-fold) Decreased (via TFEB )
Neurite outgrowthImpaired Enhanced

Resolution strategy:

  • Perform dose-response (0.1-1.0 mg/mL ) to identify biphasic effects

  • Use tetracycline-inducible systems for temporal control

  • Validate findings across ≥3 cell types (e.g., HEK293T, iPSCs, primary bovine cells )

What quality control metrics are essential for batch-to-batch reproducibility?

Beyond standard purity assays:

ParameterAcceptance CriteriaAnalytical Method
Helicity content≥40% α-helixCircular dichroism
Oligomerization stateMonomer (≥95%)SEC-MALS
Endotoxin levels<0.1 EU/µgLAL chromogenic assay
Residual DNA<1 pg/µg proteinQubit dsDNA HS assay

Note: Functional equivalence across batches requires standardized phosphorylation profiling (Phos-tag gels) due to predicted 12 phosphosites .

How can researchers optimize TMEM184C purification given its transmembrane nature?

A 4-step protocol derived from :

Step 1: Solubilization

  • Use 2% n-dodecyl-β-D-maltoside (DDM) + 0.2% cholesteryl hemisuccinate

  • Optimal pH: 8.0 (prevents C-terminal degradation)

Step 2: Immobilized metal affinity chromatography (IMAC)

  • Wash buffer: 50 mM imidazole in Tris-NaCl + 0.05% DDM

  • Elute with 250 mM imidazole

Step 3: Size-exclusion chromatography (Superdex 200 Increase)

  • Buffer: 20 mM HEPES, 150 mM NaCl, 0.03% DDM

Step 4: Concentration

  • Use 100 kDa MWCO centrifugal devices

  • Final storage: 0.5 mg/mL in 6% trehalose

What are the critical considerations when extrapolating bovine TMEM184C data to human models?

Key interspecies differences:

FeatureBovine (Q17QL9)Human (Q9NVA4)
Amino acid identity89%Reference
N-glycosylation sites2 (N85, N312)3 (N87, N314, N401)
Phosphorylation sites8 predicted12 confirmed
Splice variantsNone documented3 isoforms (NM_018241.2 etc.)

Validate cross-reactivity of antibodies using peptide arrays spanning variable regions (aa 198-215 differ most).

How to design CRISPR screens targeting TMEM184C-interacting pathways?

Leverage synthetic lethal approaches:

Primary screen:

  • Library: Human kinome + phosphatome (1,200 genes)

  • Readout: Cell viability in TMEM184C-knockout vs wildtype

Secondary validation:

  • MAP4K3 inhibitors (5 µMAP4K3i ) to mimic TFEB dysregulation

  • Wnt pathway activators (CHIR99021) to rescue neurodevelopmental defects

Data analysis:

  • Apply MAGeCK-MLE for robust hit calling (FDR <0.1)

  • Prioritize genes co-expressed with TMEM184C in GTEx brain tissues

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.