Recombinant Bovine Transmembrane protein 187 (TMEM187)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery times may vary based on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
TMEM187; Transmembrane protein 187
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-256
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM187
Target Protein Sequence
MKPESGQALFHVALASCLCVATVHTGIFEHVSVQVGYEYYAEAPVTSLPAFLAMPFNSLV NMAYVFLGVYWLRSQARAPGGPAERRRARYLKDVFAGMALVYGPVQWLRIGMQTQPTAVL DQWLTLPIFAWPVAWCLCLDRGWKPWLFLAVEGLSLCSYSLALLHPHGFELALGLHIAAA VGQALRIQGRHGNISSGTYLALGVLSCLGFVVLKLCDHELAQWHLFQQLTGHFWSKVCDV LQFHFAFLFLTSLHTC
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is bovine TMEM187 and what are its basic characteristics?

Bovine Transmembrane Protein 187 (TMEM187) is a multi-pass membrane protein that shares significant homology with human TMEM187, which is approximately 261 amino acids in length . While TMEM187 has not been extensively characterized in cattle, it appears to play roles in cellular signaling pathways, particularly those involved in metabolism and energy utilization. Based on extrapolation from human TMEM187 studies, the bovine variant likely contains multiple transmembrane domains with both cytoplasmic and extracellular regions, exhibiting tissue-specific expression patterns across rumen, liver, muscle, and fat tissues .

The protein is typically studied in recombinant form, where it is expressed in expression systems such as E. coli with purification tags (commonly His-tags) to facilitate isolation and study . Structurally, bovine TMEM187 contains several conserved domains that suggest its potential involvement in the RLMF (Rumen-Liver-Muscle-Fat) regulatory axis that influences feed efficiency in cattle .

What expression systems are most effective for producing recombinant bovine TMEM187?

The optimal expression system for recombinant bovine TMEM187 production depends on the research objectives. For basic biochemical and structural studies, bacterial expression systems such as E. coli are commonly used, similar to the approach used for human TMEM187 . When using E. coli expression systems, researchers typically employ vectors containing N-terminal His-tags for efficient purification via immobilized metal affinity chromatography (IMAC) .

For more complex functional studies requiring post-translational modifications, mammalian expression systems may be preferable. CHO or HEK293 cell lines can provide a eukaryotic environment that supports proper folding and modification of transmembrane proteins. In cases where bacterial expression results in inclusion bodies, the following refolding protocol is recommended:

  • Solubilize inclusion bodies in 8M urea or 6M guanidine hydrochloride

  • Perform stepwise dialysis to gradually remove the denaturant

  • Add phospholipids during refolding to stabilize transmembrane regions

  • Verify proper folding using circular dichroism spectroscopy

The selection of expression system should be guided by downstream applications and the specific research questions being addressed .

How can researchers verify the purity and integrity of recombinant bovine TMEM187?

Verification of recombinant bovine TMEM187 purity and integrity requires a multi-method approach. Initial assessment typically employs SDS-PAGE analysis to confirm protein size (expected approximately 21 kDa plus any fusion tags) . For transmembrane proteins, gel migration patterns may differ from theoretical molecular weights due to their hydrophobic nature.

Western blotting using anti-TMEM187 antibodies provides confirmation of identity. For detailed quality assessment, researchers should employ:

  • Mass spectrometry analysis to confirm primary sequence and identify any post-translational modifications

  • Size exclusion chromatography to assess protein homogeneity and aggregation state

  • Circular dichroism to evaluate secondary structure integrity, particularly important for transmembrane proteins

  • Dynamic light scattering to measure size distribution

For functional verification, researchers can evaluate protein-protein interactions with known binding partners such as those identified for human TMEM187 (e.g., LAGE3, L1CAM, HCFC1, or MECP2) . When working with recombinant proteins, it's critical to ensure they maintain native conformation, particularly for transmembrane proteins that may require specific lipid environments for proper folding and function .

What statistical approaches are most appropriate for analyzing TMEM187 expression data?

When analyzing TMEM187 expression data in cattle, researchers should employ robust statistical methods that account for the complex biological variability in livestock studies. For quantitative PCR or RNA-seq data comparing TMEM187 expression across different tissues or experimental conditions, mixed linear models are particularly appropriate .

The general approach should follow these steps:

  • Assess data normality using Shapiro-Wilk tests

  • Apply appropriate transformations (log, Box-Cox) if normality assumptions are violated

  • Employ Linear Mixed Models (LMM) to account for random effects such as animal-to-animal variation

  • For count-based data (RNA-seq), utilize Generalized Linear Mixed Models (GLMM) with negative binomial distribution

When analyzing correlation between TMEM187 expression and phenotypic traits like feed efficiency, researchers should use the median absolute deviation (MAD) approach as described in the literature for similar studies in cattle . This method is preferred over standard deviation metrics because:

Statistical MethodAdvantages for TMEM187 StudiesLimitations
MAD (Median Absolute Deviation)Robust to outliers; Better for non-normal distributionsLess statistical power in perfectly normal distributions
Standard DeviationWell-understood; Suitable for normally distributed dataSensitive to outliers; Problematic for skewed data
WGCNA (Weighted Gene Co-expression Network Analysis)Identifies gene modules and hub genes in regulatory networksRequires substantial sample sizes; Computationally intensive

For multi-tissue studies examining TMEM187 within the RLMF regulatory axis, consensus network construction approaches using WGCNA are recommended to identify co-expression patterns and potential functional relationships .

How can researchers effectively integrate TMEM187 data into multi-tissue regulatory axis studies in cattle?

Integration of TMEM187 data into multi-tissue regulatory axis frameworks requires sophisticated approaches to capture cross-tissue relationships. Based on established methodologies for similar studies, researchers should employ a systematic multi-transcriptomics approach following these steps:

  • Collect matched tissue samples (rumen, liver, muscle, fat) from the same animals under identical experimental conditions

  • Process RNA using standardized protocols to minimize technical variation

  • Apply MAD-based filtering to remove genes with abnormal expression values across tissues

  • Construct tissue-specific and consensus modules using WGCNA package

  • Identify TMEM187's position within these modules and its potential connections to key metabolic pathways

When analyzing TMEM187 within the RLMF axis, particular attention should be paid to its co-expression with genes involved in energy metabolism, electron respiratory chain, and protein synthesis/degradation pathways. Successful integration depends on accounting for tissue-specific expression patterns while identifying conserved regulatory mechanisms across tissues .

For optimal results, researchers should implement a data integration framework that incorporates:

  • Differential expression analysis between high and low feed efficiency animals

  • Module preservation statistics across tissues

  • Functional enrichment analysis of modules containing TMEM187

  • Identification of upstream regulators and downstream effectors

This approach enables researchers to position TMEM187 within the broader context of regulatory networks that influence economically important traits like feed efficiency in cattle .

How can researchers effectively analyze the relationship between TMEM187 and mitochondrial function in high feed efficiency cattle?

Analyzing TMEM187's relationship with mitochondrial function in the context of feed efficiency requires integrated approaches that span molecular and cellular scales. Based on established research in related areas, the following methodological framework is recommended:

  • Quantify TMEM187 expression levels in tissues with high mitochondrial density (liver, muscle) using qPCR and western blotting

  • Measure key indicators of mitochondrial function:

    • Oxygen consumption rates in isolated mitochondria

    • ATP synthesis efficiency

    • Electron transport chain complex activities

    • mtDNA copy number

    • Markers of mitochondrial uncoupling and oxidative stress

  • Apply correlation and regression analyses to identify associations between TMEM187 expression and these mitochondrial parameters

  • Implement pathway analysis focusing on genes involved in electron respiratory chain components (ND2-6, NDUF family, COX, CYTB, UQCR11, ATP6/8)

Given the findings that high feed efficiency cattle show upregulation of electron respiratory chain components and more efficient ATP synthesis, researchers should specifically investigate whether TMEM187 modulates these processes, potentially through:

  • Direct protein-protein interactions with respiratory chain components

  • Involvement in mitochondrial membrane integrity

  • Regulation of genes encoding mitochondrial proteins

  • Modulation of cellular energy sensing pathways

Analysis should employ multivariate approaches that can account for the complex relationships between gene expression, protein levels, and functional outcomes .

What are the most effective methods for conducting TMEM187 knockdown/overexpression studies in bovine cell culture models?

Conducting effective genetic manipulation studies of TMEM187 in bovine cell models requires careful selection of both techniques and cellular systems. Based on current methodological approaches, researchers should consider the following framework:

  • Cell model selection:

    • Primary bovine hepatocytes for liver-specific studies

    • Bovine satellite cells for muscle-specific functions

    • Bovine adipocyte cultures for fat metabolism investigations

    • Immortalized bovine epithelial cell lines for general expression studies

  • For TMEM187 knockdown:

    • Design 3-4 different siRNA sequences targeting conserved regions of bovine TMEM187

    • Optimize transfection conditions using lipid-based reagents specifically validated for bovine cells

    • Confirm knockdown efficiency via qPCR (>70% reduction) and western blotting

    • Include scrambled siRNA controls and mock transfection controls

  • For TMEM187 overexpression:

    • Clone the full-length bovine TMEM187 coding sequence into mammalian expression vectors

    • Add epitope tags (FLAG, HA) that don't interfere with transmembrane domains

    • Optimize transfection or viral transduction protocols for bovine cells

    • Verify expression by immunofluorescence to confirm proper cellular localization

  • Phenotypic analysis following genetic manipulation:

    • Measure metabolic parameters (oxygen consumption, ATP production)

    • Analyze expression of genes involved in electron transport chain and protein metabolism

    • Assess mitochondrial morphology and distribution

    • Evaluate cellular response to metabolic challenges

For more physiologically relevant studies, researchers should consider developing stable cell lines with inducible TMEM187 expression systems, allowing for temporal control of expression levels . When reporting results, statistical analysis should employ mixed models that account for both technical and biological variation sources .

How can researchers identify and validate the protein-protein interaction network of bovine TMEM187?

Identifying and validating the protein-protein interaction (PPI) network of bovine TMEM187 requires a multi-method approach that overcomes the challenges associated with transmembrane protein interactions. Based on established methodologies, researchers should implement the following strategy:

  • Initial PPI prediction:

    • Leverage homology-based predictions from human TMEM187 interaction data

    • Use computational tools to identify potential binding partners based on co-expression in the RLMF axis

    • Focus on proteins identified in related studies, particularly those interacting with human TMEM187 (LAGE3, L1CAM, HCFC1, MECP2)

  • In vitro validation techniques:

    • Co-immunoprecipitation assays using epitope-tagged TMEM187

    • Proximity ligation assays for detecting interactions in intact cells

    • FRET/BRET approaches for real-time interaction monitoring

    • Split-ubiquitin yeast two-hybrid systems specifically designed for membrane proteins

  • Mass spectrometry-based approaches:

    • BioID or TurboID proximity labeling to identify proteins in close proximity to TMEM187

    • Cross-linking mass spectrometry for capturing transient interactions

    • Quantitative interaction proteomics comparing different physiological states

  • Functional validation:

    • Co-localization studies using confocal microscopy

    • Knockdown/overexpression of candidate interactors to assess reciprocal effects

    • Mutagenesis of key domains to map interaction interfaces

When analyzing the resulting PPI network, researchers should apply filtering criteria to prioritize interactions most relevant to feed efficiency pathways, particularly focusing on connections to electron transport chain components, protein metabolism machinery, and regulatory proteins identified in the RLMF axis studies .

The data should be presented in a network visualization format showing confidence scores for each interaction based on the number and type of validation methods, similar to the approach used in STRING database analyses .

What bioinformatic approaches should be used to analyze TMEM187 in the context of feed efficiency GWAS data?

Effective integration of TMEM187 analysis with genome-wide association study (GWAS) data for feed efficiency requires specialized bioinformatic approaches. Based on established methodologies, researchers should implement the following analytical framework:

  • GWAS data processing:

    • Apply standard quality control filters (call rate, minor allele frequency, Hardy-Weinberg equilibrium)

    • Implement appropriate statistical models accounting for population structure

    • Generate Manhattan plots to identify significant SNPs near TMEM187 locus

  • Functional annotation of TMEM187-associated variants:

    • Characterize SNP locations (coding, intronic, regulatory regions)

    • Predict functional consequences using tools like SnpEff or VEP

    • Identify potential regulatory elements using comparative genomics

  • Integration with transcriptomic data:

    • Conduct eQTL (expression quantitative trait loci) analysis to identify variants affecting TMEM187 expression

    • Apply weighted gene co-expression network analysis (WGCNA) to position TMEM187 within functional modules

    • Use median absolute deviation (MAD) filtering to remove genes with abnormal expression patterns

  • Pathway enrichment analysis:

    • Incorporate TMEM187 into the RLMF regulatory axis framework

    • Identify enriched biological pathways associated with TMEM187 and feed efficiency

    • Focus particularly on energy metabolism, electron transport chain, and protein metabolism pathways

Researchers should construct a multi-layered data integration approach that connects genomic variants to TMEM187 expression and ultimately to feed efficiency phenotypes. This approach should leverage established methodologies while addressing the specific challenges of integrating diverse data types in livestock genomics .

Data TypeAnalysis MethodKey Software/ToolsOutput Format
GWASMixed linear modelsGCTA, PLINK, GEMMAManhattan plots, QQ plots
TranscriptomicsDifferential expression, co-expression networksDESeq2, WGCNAHeatmaps, network visualizations
Functional annotationVariant effect predictionSnpEff, VEPAnnotated variant tables
Pathway analysisEnrichment testingGSEA, IPA, STRINGEnrichment tables, pathway maps

How should researchers address discrepancies in TMEM187 expression data across different tissues and experimental conditions?

Addressing discrepancies in TMEM187 expression data across different tissues and experimental conditions requires a systematic approach to distinguish biological variation from technical artifacts. Based on established methodological approaches, researchers should implement the following framework:

  • Data normalization and quality control:

    • Apply appropriate normalization methods (e.g., RPKM, TPM, or quantile normalization)

    • Use technical replicates to establish baseline variability

    • Implement median absolute deviation (MAD) filtering to identify and address outliers

    • Calculate coefficient of variation across biological replicates

  • Statistical approaches for cross-tissue comparison:

    • Employ mixed-effects models that account for tissue-specific and animal-specific variability

    • Use paired statistical tests when comparing tissues from the same animals

    • Apply FDR correction for multiple testing when evaluating expression across many tissues

  • Experimental design considerations:

    • Control for time-of-day effects on gene expression

    • Account for nutritional status and feeding regimen

    • Document and analyze tissue collection protocols for potential sources of variability

    • Consider developmental stage and physiological state of animals

  • Integrative analysis approaches:

    • Develop tissue-specific reference ranges for TMEM187 expression

    • Identify tissue-specific regulatory factors that may influence TMEM187

    • Construct consensus modules using WGCNA to identify conserved patterns across tissues

When discrepancies persist after these approaches, researchers should consider biological explanations such as tissue-specific splicing variants, post-transcriptional regulation, or condition-specific expression control. The analytical framework should distinguish between random variation and systematic differences that may have biological significance .

What approaches should researchers use to identify the most suitable reference genes when analyzing TMEM187 expression via qPCR?

Selection of appropriate reference genes is critical for accurate qPCR analysis of TMEM187 expression in bovine tissues. Based on established methodologies, researchers should implement a systematic approach:

  • Initial candidate selection:

    • Begin with a panel of 8-10 potential reference genes from different functional classes

    • Include traditional housekeeping genes (GAPDH, ACTB) but don't rely exclusively on them

    • Consider tissue-specific stable genes identified in previous bovine studies

    • Include genes with expression levels similar to TMEM187 to avoid amplification efficiency biases

  • Stability assessment across experimental conditions:

    • Apply multiple complementary algorithms:

      • geNorm for pairwise variation analysis

      • NormFinder for intra- and inter-group variation

      • BestKeeper for correlation and standard deviation analysis

      • RefFinder for integrated ranking

    • Evaluate stability across all experimental conditions (tissues, treatments, time points)

  • Optimal reference gene number determination:

    • Calculate pairwise variation (Vn/n+1) using geNorm to determine minimum number of reference genes

    • Generally aim for at least 2-3 reference genes for normalization

    • Consider using different reference sets for different tissues if necessary

  • Validation and implementation:

    • Verify selected reference genes using independent samples

    • Report comprehensive details of reference gene selection process

    • Calculate and report reference gene stability values in methods section

How can researchers effectively combine proteomics and transcriptomics data to gain insights into TMEM187 function in the RLMF regulatory axis?

Effective integration of proteomics and transcriptomics data for understanding TMEM187 function within the RLMF regulatory axis requires specialized multi-omics approaches. Based on established methodologies, researchers should implement the following analytical framework:

  • Data generation and preprocessing:

    • Generate matched transcriptomics and proteomics data from the same tissue samples

    • Apply appropriate normalization methods specific to each data type

    • Remove batch effects using methods like ComBat or SVA

    • Filter low-quality data points using MAD-based approaches

  • Correlation analysis:

    • Calculate transcript-protein correlations for TMEM187 across tissues

    • Identify genes/proteins with concordant and discordant expression patterns

    • Apply Spearman correlation for non-parametric assessment

    • Generate correlation networks to visualize relationships

  • Pathway and functional analysis:

    • Conduct separate pathway enrichment for transcripts and proteins

    • Identify commonly enriched and unique pathways

    • Focus on energy metabolism, protein metabolism, and immune response pathways relevant to feed efficiency

    • Apply integrated pathway analysis methods like iPEAP or pathifier

  • Network integration and visualization:

    • Construct integrated networks using methods like SNF (Similarity Network Fusion)

    • Apply WGCNA to identify consensus modules across data types

    • Position TMEM187 within these integrated networks

    • Identify potential post-transcriptional regulatory mechanisms

When analyzing TMEM187 specifically, researchers should pay particular attention to potential discrepancies between transcript and protein levels, which might indicate post-transcriptional regulation relevant to the protein's function. For transmembrane proteins like TMEM187, specialized extraction protocols for proteomics should be employed to ensure adequate coverage .

What approaches should be used to characterize the functional domains of bovine TMEM187?

Characterization of functional domains within bovine TMEM187 requires a multi-faceted approach combining computational prediction, structural analysis, and experimental validation. Based on established methodologies, researchers should implement the following strategy:

  • Computational domain prediction and annotation:

    • Identify transmembrane domains using algorithms such as TMHMM, Phobius, or TOPCONS

    • Predict signal peptides and sorting signals using SignalP and TargetP

    • Identify conserved functional motifs using PROSITE, Pfam, and SMART databases

    • Perform multiple sequence alignment with TMEM187 orthologs to identify evolutionarily conserved regions

  • Structural analysis approaches:

    • Generate 3D structural models using homology modeling or ab initio prediction

    • Validate models through molecular dynamics simulations

    • Identify potential ligand binding pockets and protein-protein interaction surfaces

    • Predict post-translational modification sites that might influence domain function

  • Experimental domain mapping:

    • Generate a series of truncation and deletion constructs

    • Produce domain-specific antibodies for localization and interaction studies

    • Perform site-directed mutagenesis of predicted functional residues

    • Evaluate domain-specific effects on protein localization, stability, and function

  • Functional validation in cellular models:

    • Express domain mutants in bovine cell lines

    • Assess effects on protein trafficking and subcellular localization

    • Measure impact on mitochondrial function and energy metabolism

    • Evaluate changes in protein-protein interactions with predicted partners

Special consideration should be given to the transmembrane topology of TMEM187, as accurate determination of membrane-spanning regions is essential for understanding its functional organization. Researchers should employ complementary experimental approaches such as protease protection assays and epitope insertion scanning to validate computational predictions .

How should researchers design experiments to investigate TMEM187's role in mitochondrial energy metabolism in cattle?

Investigating TMEM187's potential role in mitochondrial energy metabolism requires carefully designed experiments that connect molecular mechanisms to physiological outcomes. Based on established methodologies and the known importance of mitochondrial function in feed efficiency , researchers should implement the following experimental design:

  • Subcellular localization studies:

    • Generate fluorescently tagged TMEM187 constructs

    • Perform co-localization studies with mitochondrial markers

    • Use subcellular fractionation to biochemically verify mitochondrial association

    • Employ super-resolution microscopy to determine precise submitochondrial localization

  • Mitochondrial function assessment following TMEM187 manipulation:

    • Measure oxygen consumption rates using Seahorse XF analyzer

    • Quantify ATP production efficiency under different substrates

    • Assess mitochondrial membrane potential using fluorescent probes

    • Evaluate reactive oxygen species production and oxidative stress markers

    • Measure activity of electron transport chain complexes I-V

  • Metabolic pathway analysis:

    • Conduct targeted metabolomics focusing on TCA cycle intermediates

    • Measure expression of genes involved in electron transport chain (ND2-6, NDUF family, COX, CYTB, UQCR11, ATP6/8)

    • Assess mitochondrial biogenesis markers (PGC-1α, TFAM, NRF1/2)

    • Evaluate mitochondrial dynamics (fusion/fission) proteins

  • Integration with feed efficiency phenotypes:

    • Correlate TMEM187 expression with RFI values in cattle

    • Compare mitochondrial parameters between high and low feed efficiency animals

    • Measure TMEM187 response to different nutritional interventions

    • Assess tissue-specific differences across the RLMF axis

The experimental design should include appropriate controls and sufficient biological replicates to account for animal-to-animal variation. Statistical analysis should employ mixed models to address the hierarchical nature of the data . Special attention should be paid to the differences between high and low feed efficiency animals, as these may provide insights into the functional significance of TMEM187 in energy metabolism .

What methods should researchers use to investigate potential post-translational modifications of bovine TMEM187?

Investigation of post-translational modifications (PTMs) in bovine TMEM187 requires specialized approaches suitable for transmembrane proteins. Based on established methodologies, researchers should implement the following comprehensive strategy:

  • Computational prediction of potential PTM sites:

    • Identify potential phosphorylation sites using NetPhos, PhosphoSite

    • Predict glycosylation sites using NetNGlyc, NetOGlyc

    • Analyze potential ubiquitination sites using UbPred

    • Identify potential palmitoylation sites using CSS-Palm

    • Assess conservation of predicted PTM sites across species

  • Mass spectrometry-based PTM identification:

    • Optimize protein extraction to maintain PTM integrity

    • Employ enrichment strategies for specific PTMs (e.g., TiO2 for phosphopeptides)

    • Use complementary fragmentation methods (CID, HCD, ETD) for comprehensive coverage

    • Implement targeted approaches (PRM, MRM) for known PTM sites

    • Apply quantitative proteomics to compare PTM levels between conditions

  • Site-specific validation techniques:

    • Generate site-specific antibodies against predicted PTM sites

    • Perform site-directed mutagenesis of putative PTM residues

    • Use Phos-tag gels for phosphorylation detection

    • Apply chemical labeling strategies for specific PTM types

    • Employ enzymatic deglycosylation to confirm glycosylation

  • Functional impact assessment:

    • Evaluate effects of PTM site mutations on protein localization

    • Assess impact on protein-protein interactions

    • Measure changes in protein stability and turnover

    • Determine effects on mitochondrial function parameters

    • Correlate PTM status with feed efficiency phenotypes

Special consideration should be given to the membrane topology of TMEM187 when interpreting PTM data, as the accessibility of sites to modifying enzymes will depend on their orientation relative to cellular compartments. Researchers should also compare PTM patterns across the RLMF axis tissues to identify tissue-specific regulatory mechanisms .

How can TMEM187 research be integrated into breeding programs for improved feed efficiency in cattle?

Integration of TMEM187 research into practical breeding programs for improved feed efficiency requires a systematic approach that connects molecular mechanisms to genetic selection strategies. Based on established methodologies in livestock breeding and molecular genetics, researchers should implement the following framework:

  • Genetic marker development:

    • Identify SNPs within and around the TMEM187 locus associated with feed efficiency

    • Develop high-throughput genotyping assays for these markers

    • Validate marker associations across different cattle breeds and production systems

    • Estimate marker effects on residual feed intake (RFI) and related traits

  • Genomic prediction implementation:

    • Incorporate TMEM187-associated markers into genomic prediction models

    • Evaluate improvement in prediction accuracy for feed efficiency traits

    • Implement multi-trait models that include TMEM187 expression data

    • Develop breeding values that account for the RLMF regulatory axis

  • Biomarker development:

    • Assess TMEM187 protein or transcript levels as potential biomarkers for feed efficiency

    • Develop practical sampling protocols for biomarker measurement

    • Evaluate correlation between biomarker levels and feed efficiency phenotypes

    • Create prediction equations incorporating biomarker data

  • Breeding program integration:

    • Design selection indices that incorporate TMEM187-related markers

    • Evaluate economic impact of selection for TMEM187-associated variants

    • Monitor genetic trends in TMEM187 allele frequencies over generations

    • Assess potential antagonistic relationships with other important traits

Researchers should consider that effective integration requires balancing the molecular complexity of the RLMF axis with the practical constraints of commercial breeding programs. A holistic approach that positions TMEM187 within the broader context of energy metabolism genes will likely be more effective than focusing on this single gene in isolation .

What experimental design considerations are most important when evaluating TMEM187 expression across different cattle breeds and production systems?

When designing experiments to evaluate TMEM187 expression across different cattle breeds and production systems, researchers must address several critical factors to ensure valid and generalizable results. Based on established experimental design principles in animal science, the following framework is recommended:

  • Sampling strategy and animal selection:

    • Implement stratified sampling across breeds, accounting for genetic diversity

    • Match animals by age, sex, and physiological state within breeds

    • Control for pedigree relationships using genetic relationship matrices

    • Calculate appropriate sample sizes based on preliminary expression variance estimates

  • Environmental standardization:

    • Standardize diet composition and feeding protocols across breeds

    • Account for production system differences through blocking and statistical modeling

    • Control or document environmental parameters (temperature, humidity, stocking density)

    • Implement appropriate adaptation periods before sampling

  • Tissue sampling standardization:

    • Establish precise anatomical locations for tissue collection

    • Standardize time of day and relation to feeding for sampling

    • Implement consistent sample processing protocols across sites

    • Use appropriate preservation methods for RNA integrity maintenance

  • Statistical design considerations:

    • Employ factorial designs to separate breed and environment effects

    • Use randomized complete block designs with appropriate blocking factors

    • Include nested factors to account for hierarchical data structure

    • Plan for repeated measures when evaluating temporal changes

The experimental design should incorporate these elements into a coherent framework based on the specific research questions being addressed. Statistical analysis should employ mixed models with random effects for animal and fixed effects for breed, production system, and their interactions . Special attention should be paid to the RLMF regulatory axis, sampling all relevant tissues (rumen, liver, muscle, fat) when possible to enable comprehensive analysis of TMEM187's role in feed efficiency across genetic backgrounds .

What are the most promising future research directions for bovine TMEM187 in feed efficiency studies?

Based on current knowledge of TMEM187 and its potential role in the RLMF regulatory axis governing feed efficiency, several promising research directions emerge for future investigation. Researchers should consider prioritizing the following areas:

  • Multi-omics integration approaches:

    • Combine genomics, transcriptomics, proteomics, and metabolomics data

    • Develop computational models of the RLMF regulatory axis incorporating TMEM187

    • Apply machine learning algorithms to identify key regulatory nodes

    • Implement systems biology approaches to model energy metabolism networks

  • Functional validation studies:

    • Develop CRISPR-Cas9 genome editing approaches for bovine TMEM187

    • Establish bovine organoid models to study tissue-specific functions

    • Conduct in vivo studies using transgenic animal models when feasible

    • Employ advanced imaging techniques to visualize TMEM187 in situ

  • Applied breeding and selection strategies:

    • Develop selection indices incorporating TMEM187 markers

    • Evaluate genetic correlations with other economically important traits

    • Implement genomic selection strategies targeting the RLMF axis

    • Assess potential for gene editing applications in breeding programs

  • Environmental interaction studies:

    • Evaluate TMEM187 expression under different dietary regimens

    • Assess response to stress conditions and environmental challenges

    • Investigate potential interactions with rumen microbiome composition

    • Study developmental programming effects on TMEM187 expression

The most promising approaches will likely integrate molecular mechanisms with practical applications, positioning TMEM187 within the broader context of the RLMF regulatory axis while addressing the complex biological processes underlying feed efficiency variation in cattle .

What methodological challenges remain in studying recombinant bovine TMEM187, and how might they be addressed?

Despite advances in recombinant protein technology and functional genomics, several significant methodological challenges persist in bovine TMEM187 research. Based on current literature and technical limitations, the following challenges and potential solutions should be considered:

  • Expression and purification challenges:

    • Challenge: Obtaining properly folded transmembrane proteins in recombinant systems

    • Solution: Implement specialized expression systems such as cell-free systems with nanodiscs or lipid bilayers; optimize detergent selection for extraction; employ GFP-fusion screening to identify optimal constructs

  • Structural characterization limitations:

    • Challenge: Determining three-dimensional structure of multi-pass transmembrane proteins

    • Solution: Apply cryo-electron microscopy; utilize NMR for specific domains; implement computational prediction with experimental validation; consider lipid cubic phase crystallization

  • Functional assay development:

    • Challenge: Creating physiologically relevant assays for transmembrane protein function

    • Solution: Develop reconstituted proteoliposome systems; implement patch-clamp techniques if channel activity is suspected; establish fluorescence-based transport assays; create cell-based reporter systems

  • Tissue-specific regulation understanding:

    • Challenge: Deciphering differential regulation across the RLMF axis

    • Solution: Develop tissue-specific conditional expression systems; implement single-cell transcriptomics; utilize spatial transcriptomics for localization; create tissue-specific knockout models

  • Translation to breeding applications:

    • Challenge: Bridging molecular mechanisms to practical selection strategies

    • Solution: Identify causal variants through functional genomics; develop high-throughput phenotyping approaches; implement multi-trait selection indices; create practical biomarker assays

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.