Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PEDS1; PDES; TMEM189; Plasmanylethanolamine desaturase; Plasmanylethanolamine desaturase 1; Transmembrane protein 189
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Protein Sequence
MAGAEDGPGQQPELEDDEAASCRRWGAQHAGARELAALYSPGKRFQEWCCVVLCFSLIAH
NMAHLLLLARWEHTPLVMLGMVAGALLADFLSGLVHWGADTWGSVELPIVGKAFIRPFRE
HHIDPTAITRHDFIETNGDNCLLTLLPLLNMAYKFRTQSPEVLEQLYPWECFVFCLIIFG
TFTNQIHKWSHTYFGLPCWVVFLQDWHVILPRKHHRIHHVSPHETYFCITTGWLNYPLER
MGFWRRLEDIIQALTGEKPRADDMKWAQKIK