Recombinant Bovine Transmembrane protein 18 (TMEM18)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is generated via bacterial expression systems :

Expression System

  • Host: Escherichia coli (E. coli)

  • Tag: N-terminal His tag for affinity chromatography

  • Purity: Confirmed via SDS-PAGE and Western blot

Functional Validation

  • DNA-binding assays confirm its C-terminal domain interacts with GCT-rich sequences .

  • Oligomerization observed in vitro, stabilizing DNA interactions .

Research Applications

Recombinant Bovine TMEM18 is utilized in:

Mechanistic Studies

  • DNA Binding: Binds single- and double-stranded DNA via its positively charged C-terminus .

  • Transcriptional Repression: Overexpression reduces luciferase reporter activity by ~50% in GCT-enriched vectors .

  • Nuclear Membrane Dynamics: Localizes to nuclear membranes, influencing chromatin organization .

Obesity and Metabolic Research

  • TMEM18 knockdown in mice increases body weight and food intake, linking it to hypothalamic feeding regulation .

  • Polymorphisms (e.g., rs6548238) correlate with BMI variability in humans .

Comparative Insights Across Species

While bovine TMEM18 shares >90% homology with human and rodent variants, functional differences are noted:

SpeciesKey Functional Differences
HumanStronger obesity risk association (SNP rs6548238 adds ~0.26 kg/m² per allele)
MouseGermline Tmem18 loss increases weight gain by 2.7 g under high-fat diets
RatInteracts with nuclear pore complex proteins (NDC1, AAAS) in immunoassays

Antibody Compatibility

  • Polyclonal antibodies (e.g., Bioss bs-11799R-BF750) detect TMEM18 in Western blot and immunofluorescence .

  • Epitope: Amino acids 41–140 (C-terminal domain) .

Limitations

  • Low solubility in non-detergent buffers due to transmembrane domains .

  • DNA-binding assays require dodecyl maltoside to maintain native conformation .

Future Directions

  • Genomic Targets: Genome-wide ChIP-seq studies are needed to map endogenous DNA-binding sites.

  • Therapeutic Potential: Modulating TMEM18 expression could address obesity or cancer metastasis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM18; Transmembrane protein 18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM18
Target Protein Sequence
MPSAFSVSRFPVSIPAVITQTDWTEPWLVGLAGFHVLCLLLTCFSSQRYRLQVGHFLCLV TLVYCAEYINEVAAMNWRLFSKHQYFDSRGMFISLVFSAPLLLNALVIVVLWVRKTLVVM TDLRSLREQRRARARPKEE
Uniprot No.

Target Background

Function
Recombinant Bovine Transmembrane protein 18 (TMEM18) functions as a transcription repressor and sequence-specific single- and double-stranded DNA binding protein, exhibiting a preference for GCT and CTG repeat sequences. It also modulates cell migration, specifically enhancing the migratory capacity of glioma-associated neural stem cells (NSCs) and neural precursor cells (NPCs).
Database Links
Protein Families
TMEM18 family
Subcellular Location
Cytoplasm. Nucleus membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of TMEM18?

TMEM18 is a small protein of approximately 140 amino acids that is primarily alpha-helical in structure. It contains three predicted transmembrane domains that anchor it to the nuclear membrane. The C-terminal region of TMEM18 is positively charged (containing the sequence ERRKEKKRRRKED) and extends outward from the membrane, containing a nuclear localization signal . Structural modeling using ROSETTA software indicates that the protein consists mainly of alpha helices, with the hydrophilic C-terminus protruding from the membrane where it can interact with DNA .

Where is TMEM18 primarily localized in cells?

TMEM18 predominantly localizes to the nuclear membrane, forming a characteristic ring-like structure around the nucleus when visualized with fluorescent tags. Cell fractionation studies have confirmed this localization pattern, showing that TMEM18 is present in both cytosolic fractions (likely associated with the endoplasmic reticulum) and nuclear fractions (primarily in the nuclear envelope) . A small portion of TMEM18 is also found in the detergent-insoluble nuclear fraction, suggesting some association with chromatin .

How evolutionarily conserved is TMEM18?

TMEM18 is highly conserved across evolutionary lines, from plants to animals, suggesting it plays an important biological role. It is robustly expressed in most tissues studied in humans, mice, rats, and fruit flies . Notable exceptions among sequenced eukaryotes are yeast and the roundworm C. elegans, which lack obvious TMEM18 homologs . This pattern suggests that while TMEM18 provides significant evolutionary benefits, it is not absolutely indispensable for cellular function.

What is the primary molecular function of TMEM18?

Research indicates that TMEM18 functions as a sequence-specific DNA-binding protein that may be involved in gene silencing . It binds to DNA through its positively charged C-terminus, with a particular preference for GCT nucleotide trimers . When TMEM18 binds to its target sequence, it can suppress gene expression, potentially by bringing the chromatin very close to the nuclear membrane, which may physically prevent access by transcriptional machinery .

How does TMEM18 bind to DNA and what sequences does it prefer?

TMEM18 binds to both single-stranded and double-stranded DNA through its positively charged C-terminal region. Systematic evolution of ligands by exponential enrichment (SELEX) experiments have revealed that TMEM18 has a preference for binding to GCT trimers in DNA sequences . This binding specificity has been confirmed through electrophoretic mobility shift assays (EMSAs), where TMEM18 showed clear binding to oligonucleotides containing GCT repeats but not to control sequences like GTG repeats .

The DNA binding function is completely dependent on the C-terminal domain - when this region is deleted (TMEM18ΔC), the protein loses its ability to bind DNA entirely . The table below summarizes the DNA binding preferences of TMEM18:

DNA SequenceTMEM18 Binding AffinityVerification Method
GCT repeatsHighSELEX and EMSA
CTG repeatsModerateSELEX
GTG repeatsVery low/NoneEMSA

Does TMEM18 form oligomers or interact with other proteins?

TMEM18 has been shown to self-associate and form dimers through co-immunoprecipitation experiments . Interestingly, deletion of the C-terminal region appears to enhance this self-association, suggesting that oligomerization occurs through domains other than the C-terminus . While initially predicted to contain a coiled-coil oligomerization domain in the C-terminus, experimental evidence indicates this is not essential for dimerization .

The oligomerization of TMEM18 may be functionally important, as it could increase DNA binding specificity by extending the length of the target sequence recognized, similar to how transcription factors like c-JUN gain additional specificity through dimerization .

What are the optimal methods for expressing and purifying recombinant TMEM18?

For recombinant expression of TMEM18, both mammalian and insect cell systems have been successfully employed. For mammalian expression, TMEM18 constructs can be cloned into vectors like pMONO-blasti-mcs and transfected into cell lines such as 293T or U2OS using transfection reagents like TransIT-2020 or Attractene .

For larger-scale production, insect cell expression systems using Sf9 or Tn5 cells with baculovirus vectors (like pK509.3) have proven effective . This approach follows standard Bac-to-Bac protocols for baculovirus production .

For purification of TMEM18, protocols typically include:

  • Cell lysis with detergent-containing buffers to solubilize membrane proteins

  • Affinity chromatography using tags (His, HA, or Flag tags are commonly used)

  • Inclusion of non-ionic detergents like dodecyl maltoside in all buffers to maintain native conformation

It's crucial to maintain detergent in all purification steps since TMEM18 is a membrane protein and requires detergent to remain soluble and properly folded.

What techniques are most effective for studying TMEM18's DNA binding properties?

Several complementary techniques have proven effective for characterizing TMEM18's DNA binding properties:

  • DNA-cellulose binding assays: Both single and double-stranded DNA linked to cellulose can be used to assess TMEM18 binding. Protein extracts containing TMEM18 are incubated with DNA-cellulose, washed, and bound protein is eluted with high salt concentration. Controls include DNase I-treated cellulose to confirm specificity for DNA .

  • Systematic evolution of ligands by exponential enrichment (SELEX): This technique involves multiple rounds of selection with oligonucleotides containing random sequences, followed by PCR amplification and sequencing to identify preferred binding motifs .

  • Electrophoretic mobility shift assay (EMSA): Using purified TMEM18 protein and biotin-labeled oligonucleotides containing potential binding sequences, this technique can confirm specific DNA binding and allow competition studies to assess relative binding affinities .

  • Chromatin immunoprecipitation (ChIP): For studying interactions with genomic DNA in cellular contexts, ChIP assays can identify regions of chromosomal DNA associated with TMEM18 .

How can researchers effectively detect and visualize TMEM18 localization in cells?

To study TMEM18 localization, researchers have successfully employed several approaches:

  • Fluorescence microscopy: Expression of TMEM18 fused to fluorescent proteins (e.g., GFP) allows direct visualization of its subcellular localization. Nuclear staining with DAPI provides a reference point to confirm nuclear envelope localization .

  • Cell fractionation followed by Western blotting: Separation of cytosolic and nuclear fractions, with further separation of nuclear proteins into detergent-soluble and insoluble fractions, can provide biochemical evidence of TMEM18 localization . This approach requires antibodies against tagged versions of TMEM18 (e.g., HA or Flag tags) or against the native protein.

  • Immunofluorescence: For detecting endogenous TMEM18, immunofluorescence with specific antibodies can be used, though this approach may be limited by antibody quality.

When performing these studies, it's important to include appropriate controls and markers for different cellular compartments to confirm specificity of localization patterns.

How can researchers assess the transcriptional repression activity of TMEM18?

To study TMEM18's effects on gene expression, luciferase reporter assays have proven effective . This approach involves:

  • Creating reporter constructs containing TMEM18 binding sites (e.g., GCT repeats) upstream of a promoter driving luciferase expression

  • Co-transfecting cells with these reporters and either control vectors or TMEM18 expression vectors

  • Measuring luciferase activity to assess transcriptional effects

In published studies, GCT repeats functioned as enhancer elements, increasing luciferase expression, while TMEM18 overexpression significantly reduced expression from reporters containing these elements . Control experiments using TMEM18 with altered DNA binding domains (e.g., TMEM18-C-JUN chimeras) confirmed specificity .

Additionally, researchers can assess effects on endogenous gene expression through:

  • RT-qPCR of candidate target genes

  • RNA-seq for genome-wide expression analysis

  • ChIP-seq to identify genomic binding sites

What is known about TMEM18's role in obesity and metabolic regulation?

TMEM18 has been implicated in obesity through genetic studies, though the precise mechanisms remain under investigation. Studies have noted TMEM18 expression in the brain, particularly in the hypothalamus, suggesting a potential role in feeding behavior regulation .

For researchers investigating TMEM18's role in metabolism, several approaches are recommended:

  • Tissue-specific expression analysis: Quantifying TMEM18 expression in metabolically relevant tissues (hypothalamus, adipose tissue, liver, muscle) under different nutritional states

  • Genetic models: Developing and characterizing knockout or overexpression models to assess metabolic phenotypes

  • Target gene analysis: Identifying and validating metabolic genes regulated by TMEM18

  • Signaling pathway integration: Determining how TMEM18 interacts with established metabolic signaling pathways

Given TMEM18's proposed function in transcriptional regulation, its effects on metabolism likely involve altered expression of genes controlling energy homeostasis.

How does TMEM18 influence cell migration and what are the downstream effectors?

TMEM18 overexpression has been reported to increase cell migration, correlating with augmented transcription of C-X-C chemokine receptor type 4 (CXCR4) . Interestingly, this may involve TMEM18-mediated repression of transcription factor Yin Yang 1 (YY1), which normally represses CXCR4 expression .

Researchers studying TMEM18's role in cell migration should consider:

  • Migration assays: Transwell, wound healing, or real-time cell analysis systems to quantify migration in response to TMEM18 modulation

  • Pathway analysis: Focusing on CXCR4 and related chemokine signaling pathways

  • Transcriptional profiling: Identifying migration-related genes affected by TMEM18

  • Rescue experiments: Testing if CXCR4 inhibition or YY1 overexpression can reverse TMEM18-induced migration

What are the mechanisms by which TMEM18 regulates chromatin architecture?

Given TMEM18's localization to the nuclear membrane and DNA binding capacity, a compelling hypothesis is that it may tether specific DNA regions to the nuclear periphery, influencing three-dimensional genome organization . This spatial reorganization could explain transcriptional repression, as the nuclear periphery is generally associated with heterochromatin and gene silencing.

To investigate this hypothesis, researchers should consider:

  • Chromatin conformation capture techniques: Hi-C, 4C, or other methods to assess changes in chromatin architecture upon TMEM18 modulation

  • DamID or APEX-based proximity labeling: To identify genomic regions associated with the nuclear periphery in the presence/absence of TMEM18

  • Live-cell imaging: Using fluorescently tagged genomic loci to track their nuclear positioning relative to TMEM18

  • Epigenetic profiling: Assessing histone modifications and DNA methylation states at TMEM18-bound regions

How do post-translational modifications affect TMEM18 function?

The activity, localization, and interactions of TMEM18 are likely regulated by post-translational modifications, though this aspect remains largely unexplored. Advanced researchers should consider:

  • Mass spectrometry analysis: To identify phosphorylation, acetylation, or other modifications

  • Mutational studies: Creating non-modifiable versions of TMEM18 (e.g., S/T→A mutations for phosphorylation sites)

  • Identifying regulatory kinases/enzymes: Through inhibitor studies or candidate approaches

  • Cell cycle and signaling dependence: Assessing how modifications change in response to cellular state

What are the species-specific differences in TMEM18 function between human and bovine orthologs?

While TMEM18 is conserved across species, functional differences may exist between human and bovine orthologs. Comparative studies could address:

  • Sequence alignment and structural modeling: Identifying conserved and divergent regions

  • DNA binding specificity: Determining if bovine TMEM18 recognizes the same target sequences

  • Protein interaction partners: Identifying species-specific interactors

  • Tissue expression patterns: Comparing expression profiles across species

  • Cross-species complementation: Testing if bovine TMEM18 can rescue functions in human cell models

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.