Recombinant Bovine Transmembrane protein 198 (TMEM198)

Shipped with Ice Packs
In Stock

Description

Functional Role in Biological Pathways

TMEM198 functions as a membrane scaffold protein in Wnt/β-catenin signaling, a pathway critical for embryogenesis, tissue homeostasis, and disease . Key findings include:

Mechanism of Action

  1. LRP6 Activation: TMEM198 binds to LRP6 (a Wnt coreceptor) and recruits casein kinase family proteins to phosphorylate key residues, enabling LRP6 activation .

  2. Wnt Signal Amplification: In Xenopus tropicalis embryos, TMEM198 is essential for:

    • Neural crest formation

    • Antero-posterior patterning

    • Engrailed-2 expression

Key Interactions

Interaction PartnerRole
LRP6Coreceptor for Wnt ligands; TMEM198 promotes its phosphorylation
Casein KinasesPhosphorylate LRP6 at serine/threonine residues for activation

Experimental Uses

  1. SDS-PAGE: Quality control to confirm purity and molecular weight (≈40 kDa) .

  2. Wnt Signaling Studies: Used to investigate LRP6 phosphorylation dynamics and β-catenin stabilization in vitro .

  3. ELISA Detection: Recombinant TMEM198 serves as a standard in sandwich ELISA assays for quantification .

Challenges and Handling Considerations

  • Storage: Repeated freeze-thaw cycles degrade activity; aliquot storage at -20°C/-80°C is mandatory .

  • Reconstitution: Requires gentle mixing to avoid protein aggregation .

Comparative Analysis with Related Proteins

While TMEM198 shares structural homology with other transmembrane proteins, its functional specificity lies in Wnt signaling modulation. Unlike TMEM190 (a separate transmembrane protein with distinct roles), TMEM198’s primary role is linked to LRP6 activation rather than ion transport or metabolic regulation .

Future Research Directions

  1. Therapeutic Potential: Investigating TMEM198’s role in diseases involving dysregulated Wnt signaling (e.g., cancer, osteoporosis).

  2. Structural Insights: Determining the crystal structure of TMEM198-LRP6 complexes to guide drug design.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order remarks, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributor.
Note: Our standard shipping includes blue ice packs. If dry ice shipment is required, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and protein stability. Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
TMEM198; Transmembrane protein 198
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM198
Target Protein Sequence
MPGTVATLRFQLLPPEPDDAFWGAPCEQPLERRYEALPALVCIMCCLFGVVYCFFGYRCF KAVLFLTGLLFGSVVIFLLCYRERVLETQLSAGASAGIALGIGLLCGLVAMLVRSVGLFL VGLLLGLLLAAAALLGSAPYYQPGSVWGPLGLLLGGGLLCALLTLRWPRPLTTLATAVTG AALIATAADYFAELLLLARYAVERLRAAPVPPLCWRSWALLALWPLLSLMGVLVQWRVTT ERDSHTEVVISRQRRRVQLMRIRQQEERKEKRRKKRPPRALPRGSRAPPRPGPPDPAYRR RPVPIKRFNGDILSPSYIQSFRDRQTGSSLSSFMASPTDADYEYGSRGPLTACSGPPVRV
Uniprot No.

Target Background

Function
TMEM198 promotes LRP6 phosphorylation by casein kinases, thus contributing to Wnt signaling. It may also function as a membrane scaffold protein, facilitating LRP6 self-aggregation and enhancing its activity.
Database Links

KEGG: bta:768235

UniGene: Bt.74146

Protein Families
TMEM198 family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell membrane. Cytoplasmic vesicle.

Q&A

What is Transmembrane Protein 198 (TMEM198) and what is its basic structure?

TMEM198 is a seven-transmembrane protein that plays a significant role in the Wnt/β-catenin signaling pathway. Structurally, it consists of a very short extracellular domain (approximately 31 amino acids in Xenopus tropicalis), seven transmembrane domains, and a cytoplasmic domain that is critical for its signaling functions. TMEM198 is conserved across species including human, mouse, and Xenopus, suggesting its evolutionary importance in cellular processes . The protein's transmembrane topology enables it to function as a scaffold protein at the cell membrane, facilitating interactions between various signaling components.

What are the primary biological functions of TMEM198?

TMEM198 functions primarily as a membrane scaffold protein that promotes LRP6 (low-density lipoprotein receptor-related protein 6) phosphorylation and activation of the canonical Wnt signaling pathway. It specifically associates with LRP6 and recruits casein kinase family proteins via its cytoplasmic domain to phosphorylate key residues important for LRP6 activation . During embryonic development, particularly in Xenopus, TMEM198 is widely distributed in the ectoderm and mesoderm and is required for Wnt-mediated neural crest formation, anteroposterior patterning, and specifically the expression of engrailed-2 . The protein demonstrates specificity in its interactions, as it activates LRP6 but not the closely related LRP5, with this specificity determined by the intracellular domain of the receptors.

How does TMEM198 interact with the Wnt signaling pathway?

TMEM198 specifically activates LRP6 in the Wnt signaling pathway through a mechanism involving protein-protein interactions and phosphorylation events. Upon association with LRP6, TMEM198 recruits casein kinase family proteins that phosphorylate key residues on LRP6, leading to its activation . Epistatic analysis has shown that TMEM198 and casein kinases are interdependent in LRP6 phosphorylation, suggesting that TMEM198 provides a membrane scaffold that recruits and facilitates kinases in phosphorylating LRP6 . Importantly, TMEM198 selectively cooperates with LRP6 but not LRP5, and this specificity relies on the intracellular domain of the LRP receptors. This is evidenced by experiments showing that when the intracellular domain of LRP5 was replaced with that of LRP6, the chimeric protein could be activated by TMEM198 as effectively as native LRP6 .

What are the challenges in expressing and purifying recombinant bovine TMEM198?

Expressing and purifying recombinant transmembrane proteins like bovine TMEM198 presents several technical challenges. Similar to other recombinant proteins expressed in bovine systems, researchers must overcome issues related to proper protein folding, post-translational modifications, and functional activity. Based on experiences with other recombinant proteins in bovine systems, such as human lactoferrin, strategies may include using bacterial artificial chromosome (BAC) vectors for gene delivery and establishing marker-free transgenic expression systems . The purification process would need to address the hydrophobic nature of the seven transmembrane domains, potentially requiring specialized detergents or amphipols to maintain protein stability. Additionally, researchers must consider the scalability of production, as seen in the lactoferrin studies where transgenic cloned cows produced recombinant proteins at concentrations of 4.5–13.6 g/L .

How does bovine TMEM198 compare structurally and functionally to human TMEM198?

While the search results don't provide direct comparative data between bovine and human TMEM198, we can infer from the conservation patterns observed across species that there would be significant structural and functional similarities. Human TMEM198 (encoded by gene NM_001005209) has been shown to activate LRP6 in Wnt signaling, and homologues from various species including Xenopus laevis, mouse, and other organisms retain similar activity levels in promoting LRP6 signaling . A comprehensive comparative analysis would involve sequence alignment to identify conserved domains, particularly in the cytoplasmic region that interacts with casein kinases and in the transmembrane domains that determine proper membrane localization. Functional studies comparing the ability of human and bovine TMEM198 to activate Wnt signaling and their binding affinities for interaction partners would provide valuable insights into any species-specific variations in activity.

What are the recommended protocols for generating recombinant bovine TMEM198 expression systems?

Based on successful approaches with other recombinant proteins in bovine systems, researchers should consider the following protocol for generating recombinant bovine TMEM198:

  • Vector Design: Utilize bacterial artificial chromosome (BAC) vectors containing the TMEM198 gene with its native regulatory elements to ensure proper expression patterns . For marker-free transgenic systems, consider techniques such as nucleofection of the BAC vector directly into bovine primary cells .

  • Cell Line Selection: Select appropriate bovine fetal fibroblast (BFF) cell lines for transfection, similar to the 0901FFB, 0904FFB, and 1003FFB lines used in the lactoferrin study .

  • Transfection and Selection: Employ nucleofection to transfect the BAC vector into bovine primary cells. To avoid using selectable marker genes, implement single-cell amplification techniques to isolate positive colonies, which can be confirmed by PCR analysis .

  • Nuclear Transfer: Use positive colonies as donor cells for somatic cell nuclear transfer (SCNT) to generate transgenic cloned embryos .

  • Embryo Transfer and Animal Propagation: Transfer blastocysts into recipients and confirm transgenic status of the resulting calves using PCR analysis with primers designed to detect different regions of the transgene. Successful transgenic animals can be further propagated through methods such as multiple ovulation and embryo transfer (MOET) .

What techniques are most effective for studying TMEM198 protein-protein interactions?

Several techniques have proven effective for studying TMEM198 protein-protein interactions:

  • Co-immunoprecipitation (Co-IP): This technique can be used to confirm interactions between TMEM198 and potential binding partners such as LRP6 and casein kinases. Tagged versions of TMEM198 (FLAG, Myc, or V5 tags) can be created for detection purposes .

  • GST Pulldown Assays: As demonstrated in previous studies, GST-TMEM198 fusion proteins (particularly the cytoplasmic domain) can be used to identify direct binding partners. The protocol typically involves incubating GST-TMEM198 bound to glutathione sepharose beads with in vitro translated or overexpressed potential interacting proteins, followed by washing and elution steps .

  • Functional Reporter Assays: TOP-FLASH reporter assays can be used to assess the functional consequences of TMEM198 interactions on Wnt signaling activation. This approach allows researchers to determine whether specific protein-protein interactions lead to signaling activation .

  • Domain Mapping: Generation of deletion constructs (e.g., TMEM198-ΔC encoding amino acids 1 to 232) and point mutations (e.g., TMEM198-M2 with mutations T168P, S171A, T172A, and T174R) can help identify critical domains and residues required for protein-protein interactions .

What analytical methods should be used to assess the functional activity of recombinant bovine TMEM198?

To assess the functional activity of recombinant bovine TMEM198, researchers should consider the following analytical methods:

  • Wnt Signaling Reporter Assays: Utilize TOP-FLASH luciferase reporter assays to measure canonical Wnt pathway activation. Active TMEM198 should promote LRP6-mediated activation of the pathway, resulting in increased reporter expression .

  • Phosphorylation Analysis: Western blotting with phospho-specific antibodies can be used to assess LRP6 phosphorylation status at key residues (such as Ser1490), which is a direct measure of TMEM198's ability to promote LRP6 activation .

  • β-catenin Accumulation Assays: Measure cytosolic β-catenin levels through Western blotting or immunofluorescence as an indicator of Wnt pathway activation. Functional TMEM198 should lead to increased β-catenin accumulation when co-expressed with LRP6 .

  • Target Gene Expression Analysis: RT-PCR or qPCR can be used to measure the expression of direct Wnt target genes such as axin2 and cyclin D1, which should be enhanced when TMEM198 is functionally active .

  • In vivo Functional Assays: For more comprehensive functional assessment, consider using model organisms like Xenopus embryos to evaluate the ability of recombinant bovine TMEM198 to rescue phenotypes resulting from knockdown of endogenous TMEM198 .

How should researchers interpret conflicting data regarding TMEM198 function across different experimental models?

When encountering conflicting data regarding TMEM198 function across different experimental models, researchers should systematically analyze potential sources of variation:

  • Species-Specific Differences: Compare sequence homology between TMEM198 from different species to identify potential structural variations that might explain functional differences. Although TMEM198 homologues from various species retain similar activity levels in promoting LRP6 signaling, subtle differences may exist .

  • Expression Level Variations: Quantify the expression levels of TMEM198 across different experimental systems, as variations in protein abundance can significantly impact functional readouts. Consider using standardized expression systems with quantifiable promoters.

  • Cellular Context Considerations: Assess the expression levels of TMEM198 interaction partners (e.g., LRP6, casein kinases) in different cell types or tissues, as the availability of these partners can influence TMEM198 function. Additionally, evaluate the status of the Wnt signaling pathway in different models.

  • Methodological Discrepancies: Carefully review experimental protocols, including cell culture conditions, transfection methods, and assay conditions, which can all contribute to apparent functional differences.

  • Statistical Validation: Ensure that experiments include appropriate controls and sufficient replication to allow for robust statistical analysis. This is particularly important when comparing results across different experimental models.

What are the key challenges in translating in vitro findings about TMEM198 to in vivo systems?

Translating in vitro findings about TMEM198 to in vivo systems presents several key challenges:

  • Physiological Expression Levels: In vitro studies often involve overexpression systems that may not accurately reflect the physiological levels of TMEM198 found in vivo. This can lead to artificial interactions or signaling outcomes that may not occur under normal conditions.

  • Complex Tissue Environment: The cellular microenvironment in tissues, including extracellular matrix components and neighboring cell interactions, can significantly influence TMEM198 function in ways that aren't captured in simplified in vitro systems.

  • Developmental and Temporal Regulation: TMEM198 expression and function may be subject to complex developmental and temporal regulation in vivo, as suggested by its role in Xenopus embryogenesis where it is required for specific developmental processes .

  • Redundancy and Compensation: In vivo systems may possess redundant mechanisms or compensatory pathways that can mask the effects of TMEM198 manipulation, potentially leading to discrepancies between in vitro and in vivo results.

  • Model Organism Relevance: When studying bovine TMEM198 in model organisms, researchers must consider the evolutionary conservation and potential species-specific differences in function. Cross-species validation studies may be necessary to confirm functional conservation.

What genomic approaches could enhance our understanding of bovine TMEM198 regulation?

Several genomic approaches could significantly enhance our understanding of bovine TMEM198 regulation:

  • Chromatin Immunoprecipitation Sequencing (ChIP-seq): This technique could identify transcription factors that bind to the bovine TMEM198 promoter and enhancer regions, elucidating the transcriptional regulation mechanisms.

  • RNA Sequencing (RNA-seq): Comparative transcriptomic analysis across different bovine tissues and developmental stages would provide insights into the temporal and spatial expression patterns of TMEM198, potentially revealing tissue-specific regulatory mechanisms.

  • CRISPR-Cas9 Genomic Editing: Creating targeted mutations in regulatory regions of the bovine TMEM198 gene could help identify critical regulatory elements. This approach could be employed in bovine cell lines before progressing to more complex in vivo models.

  • Single-Cell RNA Sequencing: This technique could reveal cell-type-specific expression patterns of TMEM198 within heterogeneous tissues, potentially identifying specialized cellular contexts where TMEM198 regulation is particularly important.

  • DNA Methylation Analysis: Investigating the methylation status of the TMEM198 promoter region across different bovine tissues could provide insights into epigenetic regulatory mechanisms controlling gene expression.

How might TMEM198 research contribute to our understanding of developmental signaling networks?

TMEM198 research has significant potential to enhance our understanding of developmental signaling networks:

  • Wnt Signaling Network Integration: As a membrane scaffold protein that promotes LRP6 phosphorylation, TMEM198 represents an important node in the Wnt signaling network. Further research could elucidate how TMEM198 integrates with other Wnt pathway regulators to fine-tune signaling output during development .

  • Cross-Pathway Communication: Investigating potential interactions between TMEM198 and components of other signaling pathways could reveal novel cross-talk mechanisms. Given the importance of coordinated signaling in development, TMEM198 might serve as a nexus for pathway integration.

  • Temporal Dynamics of Signaling: Analyzing the temporal regulation of TMEM198 expression and activity during development could provide insights into how Wnt signaling dynamics are controlled throughout embryogenesis. This is particularly relevant given TMEM198's role in Wnt-mediated neural crest formation and anteroposterior patterning .

  • Evolutionary Conservation of Developmental Mechanisms: Comparative studies of TMEM198 function across species could highlight evolutionarily conserved mechanisms in developmental signaling networks, as well as species-specific adaptations.

  • Cell Fate Determination: Given TMEM198's role in neural crest formation and patterning, further research could elucidate its contributions to cell fate decisions during development, potentially revealing new mechanisms governing lineage specification.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.