Recombinant Bovine Transmembrane protein 204 (TMEM204)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
TMEM204; CLP24; Transmembrane protein 204; Claudin-like protein 24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM204
Target Protein Sequence
MTVRKVVATAVLVALVSLVLNNAAAFTPNWVYQTLEDGRRRSVGLWWACWLVERPRGAPG PGARPGPADVRDCEALGWGSEAAGFQESRGTVKLQFDMMRACNLVATAALAAGQLTFVLG LTGLPLLSPDAQCWEEAMAAAFQLASFVLVIGLVTFYRIGPYTSLSWSCYLNIGACLLAT LAAAMLIWNVLHRREDCTAPRVIVISRSLTARFRRGLDNDYVESPC
Uniprot No.

Target Background

Function
Influences paracellular permeability and appears to be involved in cell-cell adhesion via adherens junctions.
Database Links
Subcellular Location
Cell junction, adherens junction. Cell membrane; Multi-pass membrane protein.

Q&A

What is TMEM204 and what are its primary functions?

TMEM204 (Transmembrane Protein 204) is a member of the TMEM family of proteins that regulates cell function and angiogenesis. It contains multiple transmembrane domains and plays critical roles in cellular signaling pathways. Research has shown that TMEM204 is involved in cancer progression, particularly in pancreatic cancer, and more recently in multiple other cancer types through pan-cancer analysis . The protein's structure includes several transmembrane regions that anchor it to cellular membranes, facilitating its role in cellular communication. Functionally, TMEM204 appears to be involved in regulating angiogenesis processes, which has implications for both normal physiological functions and pathological conditions such as cancer development.

How does Bovine TMEM204 differ from human and mouse orthologs?

While the exact sequence homology varies between species, bovine TMEM204 shares significant functional and structural similarities with human and mouse orthologs. Researchers should note that when working with recombinant bovine TMEM204, species-specific differences may affect antibody recognition, protein-protein interactions, and functional assays. Comparative analysis between bovine, human, and mouse TMEM204 shows conservation of key functional domains, but species-specific variations exist particularly in non-critical regions. These differences should be considered when translating findings between model systems. Mouse TMEM204 is often used as a model due to its availability as recombinant protein for experimental studies . When designing experiments with bovine TMEM204, researchers should consider these interspecies differences in experimental design and interpretation of results.

What are the recommended methods for confirming the identity of recombinant bovine TMEM204?

For confirming the identity of recombinant bovine TMEM204, researchers should employ multiple complementary methods. Western blotting using specific anti-TMEM204 antibodies is the primary method, with expected molecular weight verification. Mass spectrometry analysis should be conducted to confirm sequence identity, focusing on species-specific peptide fragments. Additionally, researchers can use fluorescence-detection size-exclusion chromatography (FSEC) to verify protein integrity and monodispersity . When using GFP-tagged recombinant TMEM204, FSEC provides valuable information about protein folding and aggregation state, which are critical indicators of protein quality. For functional verification, binding assays with known interaction partners can provide further confirmation of proper protein conformation and activity.

What expression systems are most effective for producing recombinant bovine TMEM204?

Based on research protocols for membrane proteins, mammalian expression systems generally yield the highest quality recombinant TMEM204 with proper folding and post-translational modifications. The BacMam system using HEK293S GnTI- cells has proven particularly effective for membrane proteins similar to TMEM204 . This system utilizes a baculovirus vector for transduction of mammalian cells, combining the high transfection efficiency of baculovirus with the superior protein processing capabilities of mammalian cells. The pEG BacMam vector incorporates a strong CMV promoter, synthetic intron, and WPRE motif to enhance mRNA processing and protein expression . Comparative studies with other membrane proteins have shown that mammalian expression systems can yield up to five times more protein than insect cell systems, with improved monodispersity and reduced spontaneous cleavage .

What are the optimal conditions for solubilizing and purifying bovine TMEM204?

For optimal solubilization of bovine TMEM204, a buffer containing mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations of 1-2% is recommended. The solubilization process should be performed at 4°C for 1-2 hours with gentle agitation . Following solubilization, ultracentrifugation at approximately 70,000g for 40 minutes helps remove insoluble material . For purification, immobilized metal affinity chromatography (IMAC) using His-tagged recombinant TMEM204 is effective, followed by size exclusion chromatography to isolate monodisperse protein. Throughout the purification process, maintaining buffer pH between 7.2-7.5 and including stabilizing agents such as glycerol (10%) can improve protein stability. Temperature control is crucial, with all steps conducted at 4°C to prevent protein degradation. Researchers should verify protein purity (>80%) using SDS-PAGE and western blotting methods .

How can researchers assess the quality and monodispersity of purified recombinant bovine TMEM204?

Fluorescence-detection size-exclusion chromatography (FSEC) is the gold standard for assessing protein quality and monodispersity of membrane proteins like TMEM204 . This technique allows analysis of GFP-tagged TMEM204 without extensive purification, making it ideal for screening different expression and purification conditions. A monodisperse peak on FSEC indicates properly folded protein suitable for functional studies. In addition to FSEC, dynamic light scattering (DLS) provides complementary information about size distribution and potential aggregation. Thermal stability assays, such as differential scanning fluorimetry (DSF), help determine optimal buffer conditions for maintaining protein stability. For functional assessment, binding assays with known interaction partners should be performed. The quality assessment workflow should include:

  • FSEC analysis for monodispersity

  • SDS-PAGE for purity assessment

  • Western blotting for identity confirmation

  • DLS for aggregation analysis

  • Functional binding assays

What structural features of bovine TMEM204 are critical for its function?

Bovine TMEM204 contains multiple transmembrane domains that are critical for its proper localization and function. While the complete crystal structure remains to be determined, topology predictions suggest that TMEM204 spans the membrane multiple times, with both N- and C-terminal domains playing important roles in protein-protein interactions and signaling. The transmembrane domains are particularly conserved across species, highlighting their functional importance. Researchers have found that post-translational modifications, particularly methylation, may regulate TMEM204 function, as methylation levels are altered in cancer tissues compared to normal tissues . The protein's structure facilitates its involvement in the p53 signaling pathway and Fanconi anemia pathway, as revealed by KEGG pathway analysis . When designing experiments to study structure-function relationships, researchers should consider using deletion constructs and point mutations to identify critical domains and residues.

How does methylation affect bovine TMEM204 expression and function?

Methylation plays a significant role in regulating TMEM204 expression and function. Studies have shown that in liver hepatocellular carcinoma (LIHC), TMEM204 methylation levels are higher than in normal tissues . This differential methylation pattern correlates with changes in protein expression and may influence patient prognosis. The specific methylation sites in the TMEM204 gene promoter region affect transcription factor binding, thereby modulating gene expression levels. Researchers investigating bovine TMEM204 should consider analyzing methylation patterns using bisulfite sequencing or methylation-specific PCR to understand epigenetic regulation mechanisms. The relationship between methylation and expression appears to be tissue-specific, with different patterns observed across cancer types. Future studies should focus on identifying the precise methylation sites that most significantly impact bovine TMEM204 expression and their conservation across species.

What protein-protein interactions are known for bovine TMEM204?

Through protein-protein interaction network analysis, TMEM204 has been shown to interact with several proteins involved in cellular signaling pathways. STRING database analysis reveals interactions with proteins in the p53 signaling pathway and Fanconi anemia pathway . These interactions suggest roles in DNA damage response and cell cycle regulation. When studying bovine TMEM204, researchers should consider examining these conserved interactions using techniques such as co-immunoprecipitation followed by mass spectrometry. Yeast two-hybrid screening can also help identify novel interaction partners specific to bovine TMEM204. The functional significance of these interactions can be validated through knockdown experiments or using dominant-negative constructs. The interaction network provides valuable insights into potential functional roles of bovine TMEM204 beyond its known involvement in angiogenesis.

What is the relationship between TMEM204 expression and immune cell infiltration in tumors?

In liver hepatocellular carcinoma (LIHC), high TMEM204 expression is associated with increased infiltration of multiple immune cell types, including CD8+ T cells, CD4+ T cells, macrophages, neutrophils, and myeloid dendritic cells . This correlation suggests that TMEM204 may influence the tumor immune microenvironment, potentially affecting immunotherapy responses. The mechanisms through which TMEM204 modulates immune cell recruitment remain to be fully elucidated, but may involve regulation of cytokine production or expression of adhesion molecules. When studying bovine TMEM204 in cancer models, researchers should consider analyzing immune cell populations using flow cytometry or immunohistochemistry in relation to TMEM204 expression levels. Understanding this relationship could provide insights into how TMEM204-targeted therapies might affect anti-tumor immune responses in both human and bovine cancers.

How can TMEM204 serve as a prognostic biomarker in cancer research?

TMEM204 has demonstrated significant potential as a prognostic biomarker, particularly in liver hepatocellular carcinoma (LIHC) where high expression correlates with favorable patient outcomes . Kaplan-Meier survival analysis using tools like GEPIA2, UALCAN, and Oncolnc has confirmed this prognostic value . When evaluating TMEM204 as a biomarker in bovine cancer models, researchers should consider both protein expression levels and methylation status, as both parameters have shown prognostic significance in human studies. The prognostic value appears to be cancer-type specific, necessitating careful validation in each cancer model. Multivariate analysis including other established biomarkers is recommended to determine the independent prognostic value of TMEM204. The prognostic significance may be linked to TMEM204's role in modulating immune infiltration, as higher levels of tumor-infiltrating lymphocytes generally correlate with better outcomes in many cancer types.

What are the key considerations when designing knockdown/knockout experiments for bovine TMEM204?

When designing knockdown or knockout experiments for bovine TMEM204, researchers should consider multiple approaches to ensure specificity and efficiency. For siRNA or shRNA-mediated knockdown, designing at least three independent target sequences is recommended to confirm phenotypic effects. The knockdown efficiency should be verified at both mRNA level (using qRT-PCR) and protein level (using western blotting). For CRISPR-Cas9 mediated knockout, careful guide RNA design is essential, with verification of editing efficiency through sequencing. Potential off-target effects should be assessed using control cell lines and rescue experiments with exogenous TMEM204 expression. Given TMEM204's role in cellular functions like angiogenesis and its implications in cancer, researchers should monitor changes in cell proliferation, migration, and angiogenic potential following knockdown/knockout. Additionally, changes in the expression of genes in related pathways (p53 signaling and Fanconi anemia pathways) should be assessed to understand downstream effects .

How can researchers overcome challenges in detecting low-abundance bovine TMEM204 in tissue samples?

Detecting low-abundance TMEM204 in bovine tissue samples presents several challenges that require optimization of detection methods. Enhanced immunohistochemistry protocols using signal amplification systems (such as tyramide signal amplification) can significantly improve sensitivity. For western blotting, using highly sensitive detection reagents and longer exposure times may be necessary. Enrichment techniques such as immunoprecipitation prior to western blotting can concentrate the protein of interest. At the mRNA level, digital droplet PCR offers improved sensitivity over conventional qRT-PCR for detecting low-abundance transcripts. Mass spectrometry-based approaches with prior enrichment can also be effective for protein detection and quantification. When working with tissue samples, proper sample preservation and processing are critical to prevent protein degradation. Fresh-frozen samples generally yield better results than formalin-fixed paraffin-embedded tissues for protein detection. Researchers should also consider using highly specific antibodies validated for bovine TMEM204 to minimize background and improve signal-to-noise ratio.

What are the best approaches for studying TMEM204 function in angiogenesis models?

For studying TMEM204 function in angiogenesis, both in vitro and in vivo models provide complementary insights. In vitro approaches include endothelial tube formation assays, where endothelial cells expressing various levels of TMEM204 are cultured on Matrigel to assess their ability to form capillary-like structures. Migration and proliferation assays with endothelial cells can reveal TMEM204's role in these fundamental angiogenic processes. For in vivo studies, researchers can utilize chorioallantoic membrane (CAM) assays in chicken embryos or Matrigel plug assays in mice, with either overexpression or knockdown of TMEM204. More advanced models include zebrafish transgenic lines with fluorescently labeled blood vessels for real-time visualization of angiogenesis. When working specifically with bovine TMEM204, researchers should consider using bovine endothelial cells for in vitro studies to maintain species-specific interactions. Co-culture systems with tumor cells and endothelial cells can provide insights into TMEM204's role in tumor angiogenesis. Analysis should include quantification of vessel formation, branching complexity, vessel stability, and response to angiogenic factors such as VEGF. These approaches can elucidate TMEM204's specific contributions to different aspects of the angiogenic process.

How might single-cell analysis advance our understanding of TMEM204 function?

Single-cell analysis technologies offer unprecedented opportunities to understand TMEM204 function with cellular resolution. Single-cell RNA sequencing (scRNA-seq) can reveal cell type-specific expression patterns of TMEM204 within heterogeneous tissues, particularly important in the tumor microenvironment where multiple cell types interact. This approach can identify which specific cell populations express TMEM204 at the highest levels and how this expression correlates with cell states and functions. Single-cell ATAC-seq provides insights into the chromatin accessibility of the TMEM204 gene locus across different cell types, revealing potential regulatory mechanisms. Spatial transcriptomics approaches combine TMEM204 expression data with spatial information, allowing researchers to understand how TMEM204-expressing cells are distributed within tissues in relation to anatomical features or pathological regions. For bovine researchers, applying these single-cell technologies to bovine tissues could reveal species-specific expression patterns and regulatory mechanisms. Single-cell proteomics, though still developing, could eventually provide insights into post-translational modifications of TMEM204 at the single-cell level, further enhancing our understanding of its regulation.

What are the prospects for developing TMEM204-targeted therapeutics for cancer?

The emerging role of TMEM204 in cancer progression and its association with patient prognosis suggests potential for TMEM204-targeted therapeutic approaches. Given its association with favorable prognosis in liver hepatocellular carcinoma when highly expressed , strategies to upregulate or activate TMEM204 might be beneficial in this cancer type. Conversely, in cancers where TMEM204 promotes progression, inhibition strategies could be valuable. Potential therapeutic approaches include small molecule modulators targeting TMEM204 directly or antibody-based therapies for cancers where TMEM204 is expressed on the cell surface. Gene therapy approaches to modulate TMEM204 expression could also be considered. The association between TMEM204 and immune cell infiltration suggests potential combination strategies with immunotherapies . For rational drug design, structural studies of TMEM204 are needed to identify druggable pockets or interfaces. Researchers developing TMEM204-targeted therapeutics should consider cancer-type specificity in their approach, given the context-dependent roles of TMEM204 across different cancers. Comparative studies between bovine and human TMEM204 could identify conserved functional domains as potential therapeutic targets with cross-species applications.

How might advanced structural biology techniques enhance our understanding of TMEM204?

Advanced structural biology techniques could significantly enhance our understanding of TMEM204 structure-function relationships. Cryo-electron microscopy (cryo-EM) has revolutionized membrane protein structural biology and could be applied to determine the structure of TMEM204 in various functional states. X-ray crystallography, though challenging for membrane proteins, remains valuable particularly for high-resolution structural details of specific domains. Nuclear magnetic resonance (NMR) spectroscopy can provide insights into dynamic aspects of TMEM204 structure and interactions. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) offers information about protein dynamics and conformational changes upon binding partners. Cross-linking mass spectrometry can elucidate interaction interfaces between TMEM204 and its binding partners. For bovine TMEM204 specifically, comparative structural analysis with human orthologs could reveal species-specific structural features. Molecular dynamics simulations based on experimental structures can predict conformational changes and identify potential binding sites for drug development. The integration of multiple structural biology approaches would provide a comprehensive understanding of TMEM204 structure and function, informing both basic research and therapeutic development strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.