Recombinant Bovine Transmembrane protein 214 (TMEM214)

Shipped with Ice Packs
In Stock

Description

Functional Insights from Cross-Species Studies

While bovine-specific TMEM214 research is sparse, studies in humans and rodents reveal critical roles in ER stress-induced apoptosis:

Key Mechanisms

  1. ER Stress Signaling

    • TMEM214 anchors procaspase-4 to the ER membrane, enabling its activation during unfolded protein response (UPR) .

    • Overexpression induces apoptosis via caspase-4 cleavage, while knockdown inhibits ER stress-triggered cell death .

  2. Structural Requirements

    • N-terminal region (aa 176–354): Essential for procaspase-4 binding .

    • Transmembrane domains (aa 480–500 and 616–636): Critical for ER localization .

  3. Apoptotic Pathway Independence

    • Mediates caspase-4-dependent apoptosis independently of CHOP or JNK pathways .

Research Applications and Potential Use Cases

Recombinant Bovine TMEM214 serves as a tool for studying:

ApplicationRationaleRelevance to Bovine Models
ER Stress PathwaysInvestigate TMEM214’s role in bovine cellular stress responses.Bovine ER stress models (e.g., lactation stress, heat stress).
Apoptosis ModulationAssess therapeutic targeting of TMEM214 in cattle diseases linked to apoptosis.Potential relevance to bovine viral diarrhea or mastitis.
Protein-Protein InteractionsMap interactions with bovine procaspase-4 or other UPR proteins.Comparative studies with human/rat TMEM214.

Comparative Analysis with Other Species

While bovine TMEM214 shares structural homology with human and rat orthologs, functional validation remains essential. Below is a comparison of key features:

FeatureHuman TMEM214Rat TMEM214Bovine TMEM214
ER LocalizationOuter membrane Outer membrane Presumed (based on structure)
Caspase-4 DependencyCritical Critical Hypothetical
Commercial AvailabilityLimited research-grade productsRecombinant proteins availableRecombinant protein available

Challenges and Future Directions

  1. Limited Bovine-Specific Data

    • Most mechanistic insights derive from human and rodent studies .

  2. Functional Validation

    • Require studies to confirm TMEM214’s role in bovine ER stress or apoptosis.

  3. Therapeutic Potential

    • Could inform strategies to modulate stress responses in livestock.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM214; Transmembrane protein 214
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-687
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM214
Target Protein Sequence
MAAKTAGGGRWEVVKKGRRPGAGGSGKGGGGDRRALGEANGVWKYDLTPPIQTTSTLYER GFEKIMKRQNKEQVPPPAVEPKKPGNKKQAKKVATLTNQNQKQGRFRSLEEALKALDLAD LQKELDKSQSVFSGNPSVWLKDLASYLNYKLQVPPSEPTLSQHPHDYPYSLVSRELRGII RGLLAKAAGSLELFFDHCLFTMLQELDKTPGESLHGYRICIQAILQDKPKIVTTNLGKFL ELLRSHQSRPAKCLTIMWALGQAGFTNLTEGLRVWLGIMLPVLGIKSLSPFAIAYLDRLL LMHPNLTKGFGMIGPKDLFPLLDFAYMPNNSLTPSLQEQLCQLYPRLKVLAFGAKPESTL HTYFPSFLSRATPGCPLEMKKELLRSLTECLMVDPLSTSVWRQLYPKHLSQSSLLLEHLL RSWERIPKKTQKSLQETIQSFKLTNQDLLRKGGGSNQDVVTCDSACKSLLQQARGFQLPW TRLLLLVLVFAIGFLCHDFRSHSSFQASLSGQLLQSSGVLPAGQQACTKIYSYSLQGYSW LEKTLPAWGSHLLTVVRPGLQLAWAHTNATVGFLSAHCASHLAWFGDSLANLFQRLQTQL PDTLNQLLRSLRELLLFLYHSILLPTWHMLLEALAQIQEHCHEACRGEVTWDCMKTQLSE AAHWTWLRLQDTTVAFLDWALAMISQQ
Uniprot No.

Target Background

Function

A critical mediator, in conjunction with CASP4, of endoplasmic reticulum stress-induced apoptosis. It is essential for CASP4 activation following endoplasmic reticulum stress.

Database Links
Protein Families
TMEM214 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the basic molecular structure of TMEM214 and how is it characterized?

TMEM214 is a membrane protein approximately 77kDa in size that is widely expressed at high levels across various tissues and cell types . Structurally, TMEM214 contains two distinct transmembrane domains located at its C-terminus (positioned at amino acids 480-500 and 616-636 in human TMEM214), with a large N-terminal cytoplasmic domain that extends into the cytosol . This transmembrane topology is critical to its cellular function and interactions with other proteins.

The protein is encoded by a gene that maps to chromosome 2 at position 2p23.3 in humans, with homologous locations in other mammalian species . Multiple isoforms of TMEM214 have been identified, suggesting potential functional diversity across tissues or developmental stages . The functional characterization of recombinant bovine TMEM214 would typically include confirmation of proper membrane insertion, protein folding, and ability to interact with known binding partners such as procaspase 4.

What expression systems are recommended for producing high-quality recombinant TMEM214?

Mammalian cell expression systems represent the preferred platform for producing recombinant TMEM214 proteins as they ensure proper post-translational modifications and protein folding essential for functional studies . Commonly used cell lines include HEK293, CHO, and COS cells, which provide the necessary cellular machinery for correct membrane protein processing.

When producing recombinant TMEM214, researchers should consider:

  • Expression vector selection: Vectors containing strong promoters (CMV, EF1α) coupled with appropriate purification tags (His, FLAG, GST) facilitate both expression and downstream purification .

  • Transfection method: Lipid-based transfection, electroporation, or viral transduction may be employed depending on the cell line and experimental requirements.

  • Induction conditions: Optimization of expression conditions including temperature (typically 30-37°C), induction duration, and medium composition is critical for maximizing protein yield while maintaining proper folding.

  • Purification strategy: Given TMEM214's membrane localization, detergent-based extraction methods using mild detergents (DDM, CHAPS) followed by affinity chromatography are typically employed .

For analytical purposes, recombinant TMEM214 produced in mammalian systems generally shows >80% purity as determined by SDS-PAGE analysis, with endotoxin levels below 1.0 EU per μg of protein .

How should recombinant TMEM214 be stored to maintain structural and functional integrity?

Proper storage conditions are critical for preserving the functional properties of recombinant TMEM214. Based on available protocols for similar membrane proteins, the following guidelines are recommended :

  • Short-term storage (up to 2 weeks): Store at +4°C in PBS buffer or another appropriate physiological buffer supplemented with protease inhibitors.

  • Long-term storage: Store at -20°C to -80°C, preferably in single-use aliquots to avoid repeated freeze-thaw cycles which can cause protein denaturation.

  • Storage formulation: For lyophilized preparations, reconstitute in sterile, filtered PBS immediately before use. For liquid formulations, the addition of glycerol (10-15%) may help prevent freeze-thaw damage .

  • Stability considerations: Membrane proteins including TMEM214 are generally more stable when retained in detergent micelles or lipid nanodiscs during storage, particularly if functional studies are planned.

Quality control testing should be performed periodically to assess protein integrity, including SDS-PAGE analysis, Western blotting, and functional assays specific to TMEM214's known activities such as procaspase 4 binding or ER localization studies .

What are the recommended validation methods for confirming identity and functionality of recombinant bovine TMEM214?

Comprehensive validation of recombinant bovine TMEM214 should involve multiple complementary approaches to confirm both identity and biological activity:

  • Biochemical identification:

    • Western blotting using specific anti-TMEM214 antibodies

    • Mass spectrometry analysis for peptide fingerprinting

    • N-terminal sequencing

    • SDS-PAGE with expected molecular weight comparison (approximately 77kDa)

  • Structural validation:

    • Circular dichroism spectroscopy to assess secondary structure elements

    • Limited proteolysis to confirm proper folding

    • Trypsin-protection assays to verify membrane topology

  • Functional validation:

    • Co-immunoprecipitation with known binding partners (especially procaspase 4)

    • Subcellular localization studies using immunofluorescence to confirm ER membrane targeting

    • Apoptosis induction assays following overexpression

    • ER stress response assays using established inducers like thapsigargin (TG) or brefeldin A (BFA)

  • Comparative analysis with human or rat TMEM214 to verify conserved functions across species, acknowledging potential species-specific differences in regulatory mechanisms or binding affinities.

When reporting validation results, researchers should document both positive controls (known TMEM214 activators) and negative controls (including samples with TMEM214 knockdown) to establish specificity and reproducibility of the observed effects .

How does TMEM214 mechanistically mediate ER stress-induced apoptosis, and what experimental approaches best elucidate this function?

TMEM214 serves as a critical mediator of ER stress-induced apoptosis through a well-defined molecular mechanism. Current evidence indicates that TMEM214 functions primarily as an anchoring protein that localizes to the outer membrane of the endoplasmic reticulum where it constitutively associates with procaspase 4 . This interaction is essential for the recruitment and subsequent activation of caspase 4 during ER stress conditions.

The mechanistic pathway can be outlined as follows:

  • Under normal conditions, TMEM214 is constitutively expressed and localized to the ER membrane with its N-terminal domain extending into the cytosol.

  • During ER stress (induced by misfolded protein accumulation), conformational changes or post-translational modifications may occur in the TMEM214-procaspase 4 complex.

  • This leads to the activation of procaspase 4, which initiates the apoptotic cascade specific to ER stress-induced cell death.

  • Importantly, TMEM214-mediated apoptosis operates independently of other ER stress response pathways involving CHOP induction or JNK phosphorylation, representing a distinct apoptotic mechanism .

To investigate this function experimentally, researchers should consider:

  • Overexpression and knockdown studies: Both gain- and loss-of-function approaches reveal TMEM214's role, as overexpression induces apoptosis while knockdown specifically inhibits ER stress-induced apoptosis without affecting other apoptotic pathways .

  • Domain mapping experiments: Deletion analysis of TMEM214 has identified a critical region (amino acids 176-354) within the N-terminal cytoplasmic domain that mediates interaction with procaspase 4 .

  • Subcellular fractionation combined with co-immunoprecipitation: These approaches confirm the physical association between TMEM214 and procaspase 4 specifically at the ER membrane .

  • Apoptosis assays using specific ER stressors: Thapsigargin (TG) and brefeldin A (BFA) induce ER stress-specific apoptosis that is dependent on TMEM214, while TMEM214 knockdown does not affect TNFα or DNA damage-induced apoptosis .

What is the relationship between TMEM214 and procaspase 4, and how can this interaction be experimentally studied?

TMEM214 and procaspase 4 form a crucial functional complex that is essential for ER stress-induced apoptosis. Their relationship exhibits several important characteristics that are highly relevant for research design and interpretation :

  • Physical interaction: TMEM214 constitutively associates with procaspase 4 via its N-terminal cytoplasmic domain (specifically amino acids 176-354) . This interaction occurs even under non-stress conditions, suggesting a pre-formed complex that becomes activated during ER stress.

  • Mutual dependence: There exists a bidirectional functional dependency between these proteins:

    • TMEM214-induced apoptosis is abolished by a dominant-negative mutant of procaspase 4

    • Caspase 4-induced apoptosis is inhibited by knockdown of TMEM214

  • Spatial coordination: TMEM214 anchors procaspase 4 to the outer membrane of the ER, which is critical for caspase 4 activation during ER stress. Knockdown of TMEM214 impairs the recruitment of procaspase 4 to the ER, preventing its activation .

Experimental approaches to study this interaction include:

TechniqueApplicationExpected Outcome
Co-immunoprecipitationPhysical interaction analysisDetection of TMEM214-procaspase 4 complex
Fluorescence resonance energy transfer (FRET)In vivo interaction dynamicsConfirmation of direct protein proximity
Proximity ligation assayVisualization of endogenous protein interactionsDetection of interaction in native cellular context
Domain mapping with truncation mutantsIdentification of critical binding regionsDetermination of minimal interaction domains
Site-directed mutagenesisIdentification of critical residuesSpecific amino acids required for binding
Subcellular fractionationLocalization of interactionConfirmation of ER membrane association

Researchers should also consider using the caspase 4 inhibitor Z-LEVD in their experimental designs, as it specifically blocks TG- and BFA-induced apoptosis but not TNFα- or DNA damage-induced apoptosis, further supporting the specificity of the TMEM214-caspase 4 pathway in ER stress-induced apoptosis .

What are the key experimental considerations when investigating species-specific differences in TMEM214 function between bovine and other mammalian models?

When investigating species-specific differences in TMEM214 function between bovine and other mammalian models, researchers should address several critical considerations to ensure valid comparative analyses:

  • Sequence homology and structural conservation:

    • Conduct comprehensive sequence alignment analysis between bovine TMEM214 and its human, rat, and other mammalian homologs

    • Pay particular attention to conservation of key functional domains, especially the procaspase 4 binding region (amino acids 176-354 in human) and transmembrane domains

    • Identify bovine-specific sequence variations that might impact protein-protein interactions or subcellular localization

  • Expression pattern differences:

    • Compare tissue distribution and expression levels across species using quantitative PCR, Western blotting, and immunohistochemistry

    • Document developmental regulation patterns that may differ between bovine and other mammalian models

    • Consider cell type-specific expression that may be uniquely regulated in bovine tissues

  • Functional conservation assessment:

    • Design cross-species complementation experiments where bovine TMEM214 is expressed in human or rat cells with endogenous TMEM214 knockdown to test functional rescue

    • Compare apoptotic responses to identical ER stressors across species-specific cell lines

    • Evaluate binding affinities between bovine TMEM214 and procaspase 4 compared to other species counterparts

  • Experimental design considerations:

    • Utilize species-appropriate antibodies and reagents, validating cross-reactivity where necessary

    • Develop bovine-specific cell culture models and primary cell systems

    • Consider physiological differences that might influence ER stress responses (e.g., metabolic rates, body temperature)

  • Comparative pathway analysis:

    • Investigate potential species-specific differences in parallel ER stress pathways (PERK, IRE1, ATF6)

    • Assess whether bovine TMEM214 interacts with additional or alternative partners not observed in other species

    • Document any differences in downstream signaling cascades following TMEM214 activation

This systematic comparative approach will help identify conserved functions versus species-specific adaptations in bovine TMEM214, providing insights into evolutionary mechanisms and potentially species-specific therapeutic targets.

How can TMEM214 be effectively targeted for modulating ER stress responses in experimental disease models?

Targeting TMEM214 presents a promising approach for modulating ER stress responses in various experimental disease models where ER stress-induced apoptosis plays a pathological role. Strategic approaches include:

  • Gene expression modulation strategies:

    • RNAi-mediated knockdown: Small interfering RNAs (siRNAs) targeting specific regions of TMEM214 mRNA have demonstrated efficacy in inhibiting ER stress-induced apoptosis in cell culture models

    • CRISPR/Cas9 genome editing: For creating stable knockout cell lines or animal models to study long-term effects of TMEM214 deficiency

    • Inducible expression systems: Tetracycline-regulated systems allow temporal control of TMEM214 expression for studying acute versus chronic effects

  • Protein-level interventions:

    • Dominant negative mutants: Overexpression of mutant TMEM214 lacking critical functional domains can competitively inhibit endogenous TMEM214 activity

    • Small molecule inhibitors: Design of compounds targeting the TMEM214-procaspase 4 interaction interface

    • Peptide-based approaches: Cell-penetrating peptides mimicking the procaspase 4 binding region of TMEM214 may disrupt the interaction

  • Disease-specific considerations:

    • Neurodegenerative diseases: Where ER stress is implicated in neuronal death (Alzheimer's, Parkinson's)

    • Diabetes and metabolic disorders: ER stress in pancreatic β-cells and adipocytes

    • Ischemia-reperfusion injury: Acute ER stress during tissue reperfusion

    • Viral infections: Where TMEM214 may influence host responses to viruses known to cause ER stress

  • Delivery methods for in vivo targeting:

    • Viral vectors (AAV, lentivirus) for tissue-specific delivery

    • Lipid nanoparticles for siRNA or mRNA delivery

    • Cell-specific promoters for targeted expression in disease-relevant tissues

  • Monitoring intervention efficacy:

    • Surrogate markers for ER stress (BiP/GRP78, XBP1 splicing)

    • Early apoptotic markers (annexin V binding, caspase activation)

    • Tissue-specific damage indicators

    • Functional recovery metrics depending on the disease model

Importantly, any intervention targeting TMEM214 should consider the potential compensatory activation of parallel ER stress pathways (CHOP induction, JNK phosphorylation), as TMEM214 represents one of several independent mechanisms of ER stress-induced apoptosis . Combination approaches targeting multiple pathways may prove more effective in certain disease contexts.

What are the optimal experimental designs for investigating TMEM214 involvement in pathogen-host interactions?

Investigating TMEM214's role in pathogen-host interactions requires carefully designed experimental approaches, particularly given evidence suggesting its potential contribution to host responses during infections with flaviviruses like Dengue, West Nile, and yellow fever . The following experimental framework provides a comprehensive strategy:

  • Infection models and pathogen selection:

    • Cell culture systems: Establish infection models using relevant cell types (hepatocytes, immune cells, endothelial cells) with wild-type and TMEM214-deficient backgrounds

    • Animal models: Develop conditional TMEM214 knockout mice for in vivo infection studies

    • Pathogen diversity: Include both RNA viruses (flaviviruses, coronaviruses) and other pathogens known to induce ER stress

  • TMEM214 expression and localization analysis during infection:

    • Temporal expression profiling: Monitor TMEM214 mRNA and protein levels at defined time points post-infection

    • Subcellular redistribution: Track potential changes in TMEM214 localization during infection using confocal microscopy and subcellular fractionation

    • Co-localization studies: Assess TMEM214 proximity to viral replication complexes or bacterial entry sites

  • Functional impact assessment:

    • Viral replication kinetics: Compare viral load and replication efficiency between wild-type and TMEM214-deficient conditions

    • Cell survival analysis: Measure apoptosis rates in infected cells with normal or altered TMEM214 expression

    • ER stress response: Monitor UPR pathway activation markers (BiP, PERK phosphorylation, XBP1 splicing) in relation to TMEM214 status

  • Mechanistic investigation:

    • Interaction proteomics: Identify pathogen-specific proteins that interact with TMEM214 during infection using immunoprecipitation coupled with mass spectrometry

    • Caspase 4 dependency: Determine whether TMEM214's role in infection depends on its established interaction with caspase 4

    • Pathway dissection: Use specific inhibitors of different ER stress branches to isolate TMEM214-dependent effects

  • Translational approaches:

    • Drug screening: Test compounds that modulate TMEM214 function for their impact on pathogen replication and host cell survival

    • Biomarker potential: Evaluate TMEM214 expression or modification patterns as potential diagnostic or prognostic indicators of infection severity

This experimental framework should incorporate appropriate controls, including:

  • Pathogen-specific controls (live vs. inactivated, virulent vs. attenuated strains)

  • ER stress controls (chemical inducers like thapsigargin as positive controls)

  • Specificity controls (targeting parallel ER stress pathways to distinguish TMEM214-specific effects)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.