Recombinant Bovine Transmembrane protein 216 (TMEM216)

Shipped with Ice Packs
In Stock

Description

Expression Systems

  • Host: Escherichia coli (E. coli) .

  • Vector: pET-based plasmids for high-yield expression .

  • Purity: >90% as confirmed by SDS-PAGE .

ParameterSpecification
FormLyophilized powder
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with 50% glycerol for stability
StabilityStable at -20°C/-80°C; avoid repeated freeze-thaw cycles

Role in Ciliogenesis and Photoreceptor Health

  • Ciliary Transition Zone: TMEM216 anchors basal bodies to the plasma membrane and regulates ciliary protein trafficking .

  • Photoreceptor Survival: Knockout studies in zebrafish show TMEM216 deficiency causes mislocalization of opsins (e.g., rhodopsin, GNAT2) and outer segment degeneration .

  • Hedgehog (Hh) Signaling: Competes with SUFU to bind GLI2/GLI3, preventing their proteolytic cleavage into repressors and promoting Hh pathway activation .

Pathways and Interactions

PathwayKey ProteinsFunctional Impact
Assembly of the primary cilium CEP290, CC2D2A, TCTN1Ciliogenesis and ciliary protein localization
Anchoring of basal bodies CEP164, CEP57, TMEM67Structural stability of cilia
Hedgehog signaling SUFU, GLI2/GLI3Regulation of developmental signaling

Disease Modeling

  • Ciliopathies: Used to study Joubert syndrome (retinal dystrophy, cerebellar defects) and Meckel syndrome (renal cysts, polydactyly) .

  • Photoreceptor Degeneration: Zebrafish tmem216 mutants exhibit shortened ciliary axonemes and TUNEL-positive apoptotic cells .

Biochemical Studies

  • Protein-Protein Interactions: Directly binds tectonic complex members (TCTN1, TMEM67) and Hh signaling components (SUFU, GLI2/3) .

  • Structural Analysis: Recombinant TMEM216 enables crystallography and mutagenesis studies to map functional domains .

Therapeutic Targets

  • Gene Therapy: TMEM216 mutations are candidates for CRISPR-based correction in ciliopathy models .

  • Drug Screening: Recombinant TMEM216 is used to identify small molecules that stabilize ciliary proteins .

Limitations and Future Directions

  • Species Specificity: Bovine TMEM216 shares 85% homology with human orthologs, limiting cross-species extrapolation .

  • Functional Redundancy: Overlapping roles with other tectonic complex proteins (e.g., TCTN2) complicate mechanistic studies .

Future research should prioritize high-resolution structural models and in vivo delivery systems for therapeutic validation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TMEM216; Transmembrane protein 216
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM216
Target Protein Sequence
MAPRGKRLSSTPLEILFFLNGWYYATYFLLELFIFLYKGLLLPYPTANLVLDVVMLFLYL GVEVIRLFFGTKGNLCQRKMPLGISVALTFPSTMMASYYLLLQTYVLRLEAIMNSILLFF CGSELLLEVLTLTAFSSMDRM
Uniprot No.

Target Background

Function
TMEM216 plays a crucial role in tissue-specific ciliogenesis as part of a tectonic-like complex, potentially regulating ciliary membrane composition.
Database Links
Subcellular Location
Membrane; Multi-pass membrane protein. Cytoplasm, cytoskeleton, cilium basal body.

Q&A

What is TMEM216 and what are its core structural characteristics?

TMEM216 is a tetraspan transmembrane protein localized at the ciliary transition zone. The protein contains four transmembrane domains with both N- and C-termini facing the cytoplasm. This architecture is characteristic of tetraspanin proteins, though TMEM216 has distinctive features that separate it from classic tetraspanins. The protein is relatively small (approximately 14 kDa) and highly conserved across vertebrate species. Structurally, TMEM216 forms part of the transition zone tectonic complex, which is essential for proper ciliogenesis and ciliary function . The protein localizes primarily to the base of the primary cilium or adjacent basal body, as demonstrated through immunofluorescence staining with antibodies against specified epitopes (aa 81-90) in ciliated cell lines like IMCD3 and hRPE .

What is the expression pattern of TMEM216 in different tissues?

TMEM216 exhibits a broad expression pattern across multiple tissues and organs. In developmental studies, TMEM216 has been detected in the central nervous system, retina, kidney, cartilage, and limb buds. Within the retina specifically, expression has been observed in all cell layers including the outer nuclear layer, inner nuclear layer, and ganglion cell layer . In zebrafish, tmem216 mRNA is widely distributed in multiple organs including the eye, pronephros, brain, liver, intestine, and muscle . The expression pattern is maintained throughout development and into adulthood, suggesting constitutive functions across various tissues. This wide distribution pattern aligns with the multisystemic nature of ciliopathies associated with TMEM216 mutations.

How does TMEM216 participate in ciliary function and maintenance?

TMEM216 plays a critical role in ciliogenesis and ciliary maintenance through several mechanisms:

  • Centrosome docking and positioning - TMEM216 is required for correct docking of centrosomes at the apical cell surface, which is a prerequisite for ciliogenesis. Knockdown of TMEM216 prevents this process in polarized cells .

  • Regulation of ciliary protein localization - TMEM216, as part of the transition zone complex, functions as a gatekeeper that regulates the entry and exit of proteins to the ciliary compartment. Loss of TMEM216 results in mislocalization of outer segment proteins in photoreceptors, including rhodopsin, GNAT2, and red opsin .

  • Maintenance of ciliary structure - TMEM216 deletion leads to shortened photoreceptor ciliary axonemes and abnormal disc morphology in the outer segments, indicating its role in structural maintenance .

  • Modulation of signaling pathways - TMEM216 appears to modulate Dvl and RhoA signaling pathways, which are important for actin-dependent polarized cell behavior and morphogenetic movements .

What expression systems are optimal for producing recombinant bovine TMEM216?

The optimal expression system for recombinant bovine TMEM216 depends on experimental goals, but several approaches have demonstrated success with similar membrane proteins:

Expression SystemAdvantagesLimitationsSpecial Considerations
Mammalian cells (HEK293, CHO)Native post-translational modifications; Proper folding; Potential for functional studiesHigher cost; Lower yieldCo-expression with chaperones may improve yield
Insect cells (Sf9, Hi5)Higher yield than mammalian cells; Good for structural studiesDifferent glycosylation patternsBaculovirus expression system optimization required
E. coli with fusion partnersHigh yield; Cost-effectiveRefolding often necessary; Lacks post-translational modificationsFusion with solubility-enhancing tags (MBP, SUMO) recommended
Cell-free systemsRapid expression; Avoids toxicity issuesLower yield for membrane proteinsSupplementation with detergents or lipid nanodiscs necessary

For functional studies, mammalian expression systems using codon-optimized bovine TMEM216 sequences with epitope tags (such as FLAG or His6) at either terminus are recommended. For higher yield production, insect cell systems with careful optimization of detergent extraction conditions have shown promise for similar tetraspan membrane proteins.

What are the recommended approaches for validating TMEM216 knockout or knockdown models?

Validation of TMEM216 knockout or knockdown models should utilize multiple complementary approaches:

  • Genetic validation:

    • PCR and sequencing to confirm target modification

    • RT-PCR and qPCR to verify reduced mRNA expression

    • For CRISPR-edited models, assessment of potential off-target effects

  • Protein validation:

    • Western blotting with validated antibodies

    • Immunofluorescence to confirm loss of protein localization at the ciliary base

    • Mass spectrometry for comprehensive protein detection

  • Functional validation:

    • Ciliogenesis assays measuring percentage of ciliated cells

    • Centrosome docking assessment through immunofluorescence

    • Ciliary length measurement using acetylated α-tubulin staining

    • Assessment of outer segment protein localization in retinal models

  • Rescue experiments:

    • Complementation with wild-type TMEM216 to restore normal phenotype

    • Structure-function analysis with domain-specific mutants

The zebrafish tmem216 knockout model demonstrated several phenotypic alterations that serve as excellent validation markers, including photoreceptor degeneration, mislocalization of outer segment proteins, and altered disc morphology .

What methods are most effective for studying TMEM216 protein-protein interactions?

Several complementary approaches can be used to investigate TMEM216 protein-protein interactions:

MethodApplicationStrengthsLimitations
Co-immunoprecipitationVerification of binary interactionsCan detect native complexesMay not detect weak or transient interactions
Proximity labeling (BioID, APEX)Identification of proximal interactorsMaps spatial relationships in living cellsMay identify proximal but non-interacting proteins
Yeast two-hybridScreening for novel interactorsHigh-throughput capabilityHigh false positive rate for membrane proteins
FRET/BRETDynamic interactions in living cellsReal-time interaction monitoringRequires fluorescent/bioluminescent tags
Crosslinking mass spectrometryIdentifying interaction interfacesProvides structural informationComplex data analysis

Previous research has successfully demonstrated interaction between TMEM216 and Meckelin using reciprocal co-immunoprecipitation experiments with GFP-tagged TMEM216 and antibodies against either N- or C-terminal portions of Meckelin . This approach can be extended to bovine TMEM216 using epitope-tagged constructs. For comprehensive interactome mapping, proximity labeling methods (BioID or TurboID) with the enzyme fused to TMEM216 would allow identification of the protein neighborhood at the ciliary transition zone.

How do mutations in TMEM216 lead to ciliopathies such as Joubert syndrome?

TMEM216 mutations disrupt ciliary function through multiple mechanisms that collectively impair cellular homeostasis:

  • Defective ciliogenesis - TMEM216 knockdown prevents ciliogenesis in polarized cells by disrupting centrosome docking at the apical cell surface . This fundamental defect prevents formation of the primary cilium, which is essential for multiple signaling pathways.

  • Compromised transition zone function - As part of the tectonic complex, TMEM216 regulates protein entry and exit from the ciliary compartment. Mutations disrupt this gatekeeper function, leading to abnormal protein localization within the cilium.

  • Aberrant signaling pathway modulation - TMEM216 loss increases phosphorylation of Dvl1 and affects RhoA signaling , which has downstream effects on developmental and homeostatic processes.

  • Structural defects in specialized cilia - In photoreceptors, TMEM216 deletion results in shortened ciliary axonemes and abnormal disc morphology in the outer segments , affecting their light-sensing capabilities.

  • Reduced gene expression - Certain mutations in the promoter region (c.-69G>A, c.-69G>T) reduce TMEM216 expression levels , leading to a partial loss of function that specifically affects photoreceptors.

These mechanisms explain the tissue-specific manifestations observed in ciliopathies, with particular impact on tissues that rely heavily on ciliary function, such as the retina, cerebellum, and kidneys.

How can recombinant bovine TMEM216 be used to study photoreceptor degeneration mechanisms?

Recombinant bovine TMEM216 provides valuable tools for investigating photoreceptor degeneration mechanisms through several experimental approaches:

  • Structure-function relationship studies:

    • Introducing disease-associated mutations into recombinant bovine TMEM216

    • Assessing impact on protein stability, localization, and interaction partners

    • Comparing bovine variants with human disease mutations

  • Protein interaction networks:

    • Using tagged recombinant TMEM216 as bait in pulldown experiments

    • Identifying tissue-specific interaction partners in bovine retinal extracts

    • Mapping the transition zone interactome in photoreceptor cells

  • Rescue experiments in model systems:

    • Testing if bovine TMEM216 can rescue phenotypes in zebrafish or mouse models

    • Comparative analysis of species-specific functional differences

    • Structure-guided design of stabilized TMEM216 variants for enhanced rescue

  • In vitro assays:

    • Reconstituting TMEM216-containing complexes with purified components

    • Assessing impact on membrane organization and protein trafficking

    • Developing high-throughput screens for compounds that stabilize mutant TMEM216

The zebrafish model is particularly valuable as TMEM216 knockout results in photoreceptor degeneration characterized by increased TUNEL-positive nuclei in the retina, mislocalization of outer segment proteins, and abnormal disc morphology in the outer segments . These phenotypes closely mirror human retinal ciliopathies, making it an excellent system for testing bovine TMEM216 variants.

What are the molecular mechanisms by which TMEM216 regulates outer segment formation in photoreceptors?

TMEM216 regulates photoreceptor outer segment formation through several interconnected mechanisms:

  • Ciliary axoneme formation - TMEM216 is essential for proper ciliary axoneme extension, as evidenced by shortened axonemes in knockout models . The axoneme serves as the structural scaffold upon which outer segment discs are organized.

  • Protein trafficking - TMEM216 ensures proper localization of outer segment proteins like rhodopsin, GNAT2, and red opsin. In TMEM216-deficient photoreceptors, these proteins mislocalize to the inner segment and cell bodies rather than concentrating in the outer segment .

  • Disc morphogenesis - Electron microscopy of TMEM216 knockout photoreceptors reveals abnormal disc morphology, including shortened discs and vesicles/vacuoles within the outer segment . This suggests TMEM216 influences the mechanisms of disc membrane biogenesis.

  • Transition zone gating - As part of the tectonic complex, TMEM216 contributes to selective barrier function at the ciliary base, regulating what proteins can enter the ciliary/outer segment compartment.

  • Interaction with cytoskeletal elements - TMEM216 influences F-actin organization , which may contribute to the structural support necessary for outer segment disc stacking and maintenance.

Understanding these mechanisms has important implications for developing therapeutic strategies for retinal ciliopathies.

How can transcriptional regulation of TMEM216 be studied and manipulated in research contexts?

Investigation of TMEM216 transcriptional regulation can be approached through several methodologies:

  • Promoter analysis:

    • Luciferase reporter gene assays to assess promoter activity under different conditions

    • Site-directed mutagenesis to evaluate the impact of specific sequence variants

    • Recent research identified two rare nucleotide substitutions (c.−69G>A, c.−69G>T) that reduced promoter activity

  • Transcription factor binding studies:

    • Electrophoretic mobility shift assays (EMSA) to identify protein-DNA interactions

    • Chromatin immunoprecipitation (ChIP) to validate transcription factor binding in vivo

    • The Find Individual Motif Occurrences (FIMO) tool can predict transcription factor binding sites affected by variants

  • Epigenetic regulation:

    • Bisulfite sequencing to map DNA methylation patterns at the TMEM216 locus

    • ChIP for histone modifications to characterize chromatin state

    • ATAC-seq to assess chromatin accessibility at the promoter region

  • Expression analysis:

    • qPCR to quantify transcript levels under different conditions

    • RNA-seq for comprehensive transcriptome analysis

    • Nanopore sequencing can confirm allele-specific expression in heterozygous carriers

For manipulating TMEM216 expression, several approaches can be employed:

  • CRISPR activation (CRISPRa) to enhance endogenous expression

  • CRISPR interference (CRISPRi) for targeted repression

  • Small molecule modulators of relevant transcription factors

  • Synthetic promoters for controlled expression in experimental systems

What approaches can be used to investigate the evolutionary conservation of TMEM216 structure and function across species?

The evolutionary conservation of TMEM216 can be investigated through multiple complementary approaches:

  • Sequence analysis:

    • Multiple sequence alignment of TMEM216 orthologs across species

    • Calculation of conservation scores for individual amino acid positions

    • Identification of conserved functional domains and motifs

    • Phylogenetic tree construction to understand evolutionary relationships

  • Structural conservation:

    • Homology modeling based on related membrane proteins

    • Analysis of predicted secondary structure conservation

    • Identification of conserved topological features across species

    • Evolutionary coupling analysis to identify co-evolving residues

  • Functional conservation:

    • Cross-species rescue experiments (e.g., bovine TMEM216 in zebrafish knockouts)

    • Comparative interactome mapping across species

    • Analysis of expression patterns in homologous tissues

    • Targeted mutagenesis of conserved residues to assess functional importance

  • Evolutionary rate analysis:

    • Calculation of dN/dS ratios to identify selection pressure

    • Detection of accelerated evolution in specific lineages

    • Identification of species-specific adaptations

This evolutionary perspective is particularly important for interpreting human disease mutations and understanding fundamental aspects of ciliary biology across vertebrates.

How does TMEM216 interact with other components of the tectonic/B9 complex to regulate ciliary function?

TMEM216 functions as an integral component of the transition zone tectonic/B9 complex, interacting with multiple proteins to regulate ciliary function:

Complex ComponentInteraction with TMEM216Functional Significance
Meckelin (TMEM67)Direct physical interaction demonstrated by co-immunoprecipitation Mutual stabilization; collaborative roles in ciliogenesis
TCTN1, TCTN2, TCTN3Part of same protein complexFormation of functional tectonic complex at transition zone
B9D1Associated through tectonic complexEstablishment of transition zone architecture
MKS1Functional interaction in same pathwayCiliary membrane composition regulation
CC2D2APart of overlapping protein complexStructural organization of ciliary base
CEP290Functional interactionCoordination of transition zone assembly

The tectonic/B9 complex collectively serves three primary functions:

  • Formation of a diffusion barrier at the ciliary base that restricts entry of non-ciliary proteins

  • Facilitation of transport for ciliary-destined cargo

  • Structural organization of the transition zone architecture

Disruption of TMEM216 impacts the entire complex's function, as evidenced by the phenotypic similarities between mutations in different complex components. For example, defects in ciliogenesis and ciliary protein localization are common features of mutations affecting TMEM216, Meckelin, and other complex members .

Advanced imaging techniques such as super-resolution microscopy have begun to reveal the precise spatial organization of these proteins within the transition zone, with TMEM216 positioned strategically to interact with both membrane and cytosolic components of the complex.

What are the major challenges in producing functional recombinant TMEM216 and how can they be overcome?

Production of functional recombinant TMEM216 presents several technical challenges due to its nature as a tetraspan membrane protein:

  • Protein expression challenges:

    • Low expression levels in heterologous systems

    • Potential toxicity to host cells when overexpressed

    • Improper folding leading to aggregation

    Solutions:

    • Use of inducible expression systems with tight regulation

    • Codon optimization for the expression host

    • Co-expression with molecular chaperones

    • Fusion with solubility-enhancing tags (MBP, SUMO, Trx)

    • Expression as truncated domains for structural studies

  • Membrane extraction and purification:

    • Difficulty maintaining native conformation during detergent solubilization

    • Loss of interacting partners during purification

    • Low yield of properly folded protein

    Solutions:

    • Screening detergent panels for optimal extraction conditions

    • Utilizing mild detergents (DDM, LMNG) or novel amphipols

    • Implementing lipid nanodiscs for maintaining native-like environment

    • Adding stabilizing lipids during purification

    • Size-exclusion chromatography to isolate properly folded fraction

  • Functional validation:

    • Lack of simple activity assays for transition zone proteins

    • Difficulty assessing proper folding and functionality

    Solutions:

    • Thermal shift assays to assess protein stability

    • Binding assays with known interaction partners (e.g., Meckelin)

    • Reconstitution into proteoliposomes for functional studies

    • Complementation assays in knockout cell lines

These approaches have been successfully applied to other tetraspan membrane proteins and could be adapted for bovine TMEM216 production with appropriate modifications.

How can researchers differentiate between direct and indirect effects when studying TMEM216 dysfunction in cellular models?

Distinguishing direct from indirect effects of TMEM216 dysfunction requires a systematic approach:

  • Temporal analysis:

    • Time-course experiments following TMEM216 depletion or mutation

    • Identification of earliest detectable changes (likely direct effects)

    • Mapping of sequential events to establish causal relationships

  • Rescue experiments:

    • Complementation with wild-type TMEM216 to reverse phenotypes

    • Structure-function analysis with domain-specific mutants

    • Rescue with downstream effectors to bypass TMEM216 requirement

  • Proximity-based approaches:

    • BioID or APEX2 proximity labeling to identify proteins in close physical proximity to TMEM216

    • Changes in the immediate protein neighborhood likely represent direct effects

  • Acute versus chronic manipulation:

    • Comparison of acute depletion (e.g., auxin-inducible degron system) versus long-term knockout

    • Acute effects are more likely to be direct consequences of TMEM216 loss

  • Cross-validation in multiple models:

    • Comparison of phenotypes across different cell types and organisms

    • Consistent early phenotypes across models suggest direct effects

  • Molecular pathway analysis:

    • Phosphoproteomic analysis following TMEM216 depletion

    • Transcriptomic profiling at early timepoints

    • Metabolomic analysis to identify immediate metabolic consequences

In zebrafish models, researchers distinguished direct effects of TMEM216 loss (shortened ciliary axonemes, altered centrosome docking) from secondary consequences (photoreceptor degeneration, increased TUNEL-positive nuclei) , providing a framework for similar analyses in bovine systems.

What are the most sensitive methods for detecting low levels of TMEM216 expression in tissue samples?

Detection of low-level TMEM216 expression requires highly sensitive techniques:

MethodDetection LimitAdvantagesLimitationsSpecial Considerations
Droplet digital PCR (ddPCR)Single-molecule detectionAbsolute quantification; High precision for low copy numbersLimited multiplexingRequires careful primer design
Single-cell RNA-seqSingle-cell resolutionCell-type specific expression; Detects heterogeneityExpensive; Complex analysisSample preparation critical
RNAscope in situ hybridization~1-2 mRNA copies per cellCellular and subcellular localization; Compatible with FFPE samplesProbe design expertise requiredSignal amplification steps must be optimized
Proximity ligation assay (PLA)Single protein moleculeIn situ protein detection; High specificityRequires two antibodiesDual recognition increases specificity
Mass spectrometry with targeted MRMFemtomole rangeDirect protein detection; QuantitativeComplex sample preparationRequires synthetic peptide standards
Nanopore direct RNA sequencingSingle moleculeLong reads; Direct detection without amplificationHigh error rateEnables detection of transcript isoforms

For TMEM216, researchers have successfully employed:

  • qPCR with normalization to housekeeping genes (e.g., GAPDH)

  • Nanopore sequencing to confirm allele-specific expression in heterozygous carriers

  • In situ hybridization with antisense probes for tissue localization

When working with bovine samples, species-specific optimization of primers and probes is essential, and validation with positive controls (tissues known to express TMEM216) is recommended to establish detection limits.

How might the study of TMEM216 contribute to understanding the broader field of ciliopathies?

TMEM216 research offers several unique insights into ciliopathy mechanisms:

  • Transition zone architecture and function:

    • TMEM216, as a component of the tectonic complex, provides a window into understanding how the transition zone regulates ciliary composition

    • Studies of TMEM216 interaction partners reveal the molecular organization of this critical ciliary region

    • Comparison of TMEM216 mutations with other transition zone protein mutations helps define shared and distinct mechanisms

  • Tissue-specific requirements:

    • The distinct phenotypes observed in TMEM216-related ciliopathies highlight differential requirements across tissues

    • Non-coding mutations affecting TMEM216 expression (c.−69G>A, c.−69G>T) cause isolated retinal disease without systemic features , suggesting photoreceptors are particularly sensitive to TMEM216 levels

    • This helps explain the phenotypic heterogeneity of ciliopathies, where different mutations in the same gene can cause distinct clinical presentations

  • Evolutionary insights:

    • Conservation of TMEM216 across species allows comparative studies to identify fundamental versus specialized ciliary functions

    • Understanding species-specific differences in TMEM216 function may explain varying susceptibilities to ciliopathies

    • Bovine models provide particular advantages due to their retinal similarities with humans

  • Therapeutic development:

    • TMEM216 research informs potential intervention points for ciliopathies

    • Understanding how specific mutations affect function guides precision medicine approaches

    • Gene therapy strategies targeting TMEM216 expression could be applicable to other ciliopathies with similar mechanisms

What novel methodologies are being developed for studying membrane protein complexes that could be applied to TMEM216 research?

Several cutting-edge methodologies can advance TMEM216 research:

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis of purified TMEM216-containing complexes

    • Cryo-electron tomography of ciliary transition zones to visualize TMEM216 in native context

    • These approaches could reveal the structural organization of the tectonic complex

  • Advanced imaging techniques:

    • Super-resolution microscopy (STORM, PALM) for precise localization within the transition zone

    • Lattice light-sheet microscopy for live imaging of TMEM216 dynamics

    • Correlative light and electron microscopy (CLEM) to connect protein localization with ultrastructure

  • Membrane protein structural biology innovations:

    • Lipid cubic phase crystallization for membrane protein structure determination

    • SMALPs (styrene maleic acid lipid particles) for extraction of membrane proteins with native lipid environment

    • Cell-free expression into nanodiscs for functional reconstitution

  • Genome engineering:

    • Base editing for precise introduction of disease-associated variants

    • Prime editing for challenging sequence contexts

    • CRISPR screens targeting TMEM216 regulatory elements

  • Single-molecule techniques:

    • Single-molecule FRET to study conformational dynamics

    • Single-molecule force spectroscopy to measure interaction strengths

    • Single-particle tracking to analyze diffusion behavior in membranes

Application of these methods to bovine TMEM216 would advance understanding of its function in both normal physiology and disease states.

How might the understanding of TMEM216 function inform therapeutic development for retinal ciliopathies?

Understanding TMEM216 function offers several therapeutic avenues for retinal ciliopathies:

  • Gene therapy approaches:

    • Supplementation of wild-type TMEM216 for loss-of-function mutations

    • Promoter-targeted approaches for non-coding mutations affecting expression levels

    • Gene editing to correct specific mutations using CRISPR-based technologies

    • These approaches are particularly promising as AAV-based retinal gene therapy has established clinical precedent

  • Small molecule development:

    • Compounds that stabilize mutant TMEM216 protein

    • Modulators of interacting proteins to compensate for TMEM216 dysfunction

    • Drugs targeting downstream pathways affected by TMEM216 loss

    • High-throughput screens using photoreceptor phenotypic readouts could identify candidates

  • Protein replacement strategies:

    • Cell-penetrating TMEM216 fragments that retain key functions

    • Engineered protein variants with enhanced stability or function

    • Recombinant bovine TMEM216 could provide insights for designing optimized therapeutic proteins

  • Cell therapy approaches:

    • Transplantation of photoreceptor precursors with normal TMEM216 function

    • In vitro modeling with patient-derived retinal organoids to test personalized treatments

    • Development of differentiation protocols guided by TMEM216 developmental expression patterns

  • Combinatorial approaches:

    • Targeting multiple transition zone proteins simultaneously

    • Addressing both structural and signaling defects

    • Personalized approaches based on specific mutations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.