Recombinant Bovine Transmembrane protein 218 (TMEM218)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of TMEM218

TMEM218 is a small protein consisting of 115 amino acids with presently limited characterized function. Despite its small size, this protein demonstrates remarkable evolutionary conservation across species, suggesting its critical biological importance . The protein's structure features transmembrane domains that anchor it within cellular membranes, contributing to its functional role in various tissues.

The gene encoding TMEM218 has been extensively mapped and studied across multiple species. In rats, for instance, the gene has been thoroughly documented in the Rat Genome Database, with associated sequences available in multiple reference databases including RefSeq (NM_001008325) and GenBank (BC085342) . This conservation across species highlights TMEM218's biological significance and suggests fundamental cellular functions that have been preserved throughout evolution.

Expression Patterns

Expression analysis has revealed that TMEM218 is predominantly found in tissues containing ciliated or flagellated cells. Specifically, the protein shows notable expression in:

  • Renal epithelial cells

  • Retinal tissue

  • Respiratory epithelium

  • Ependymal and choroid plexus cells

  • Reproductive tissues (vas deferens, epididymis, and spermatids)

  • Various endocrine cells including pancreatic islets, pituitary gland, adrenal medulla, parathyroid gland, and thyroid C-cells

This expression pattern strongly correlates with the protein's suspected role in ciliary development and function, which has significant implications for understanding related pathologies.

Biological Significance of TMEM218

Research utilizing knockout mouse models (Tmem218−/−) has provided critical insights into the biological function of TMEM218. These studies have demonstrated that TMEM218 deficiency leads to two primary pathological outcomes: progressive cystic kidney disease and retinal degeneration . These findings are particularly significant as they mirror the clinical presentation of Senior-Løken syndrome in humans, suggesting that the Tmem218−/− mouse could serve as a valuable model for this condition.

The kidney pathology in TMEM218-deficient mice is characterized by:

  • Diffuse renal cyst development

  • Progressive interstitial fibrosis

  • Collagen deposition throughout the kidney

  • Tubular basement membrane disintegration

  • Tubular atrophy and cyst formation

  • Scattered glomerular cysts

Concurrently, the retinal pathology includes:

  • Slowly progressive retinal degeneration

  • Diffuse thinning of the outer nuclear layer

  • Degeneration of photoreceptor inner and outer segments

  • Relatively preserved inner retina with normal inner nuclear and ganglion cell layers

These pathological features strongly suggest that TMEM218 plays a critical role in ciliary biogenesis or function, as many ciliopathies present with similar renal and ocular manifestations.

Recombinant Bovine TMEM218: Production and Characteristics

Recombinant bovine Transmembrane protein 218 (TMEM218) represents a biotechnologically engineered form of the native bovine protein, produced using recombinant DNA technology . The recombinant form enables researchers to study the protein's structure, function, and potential interactions without the limitations associated with extracting the native protein from animal tissues.

Commercial availability of recombinant bovine TMEM218 has facilitated research in this field. Companies such as MyBioSource offer partial recombinant bovine TMEM218 products (such as catalog number MBS7057718) for research applications . Similarly, Creative BioMart lists recombinant TMEM218 proteins from various species, including bovine, produced in different expression systems like mammalian cells, HEK293 cells, and E. coli .

Production Methods

Recombinant bovine TMEM218 is typically produced using one of several expression systems:

Expression SystemAdvantagesLimitationsCommon Tags
E. coliHigh yield, cost-effective, rapid productionLimited post-translational modificationsHis, Non, Avi
Mammalian cells (HEK293)Proper folding, post-translational modificationsHigher cost, lower yieldHis, Fc
Insect cellsHigher yield than mammalian, some post-translational modificationsMore complex than bacterial systemsHis, GST

The choice of expression system depends on the specific research requirements, particularly whether post-translational modifications are essential for the protein's functionality in experimental conditions.

Research Applications of Recombinant Bovine TMEM218

Recombinant bovine TMEM218 has emerged as a valuable research tool for investigating ciliopathies and related disorders. The protein enables several key research applications:

Model Systems for Ciliopathies

The association between TMEM218 dysfunction and ciliopathies makes recombinant bovine TMEM218 particularly valuable for developing in vitro model systems. These models can help elucidate the pathogenic mechanisms underlying conditions such as Senior-Løken syndrome, Joubert syndrome, and Meckel syndrome .

Comparative Studies

Bovine TMEM218 shares significant homology with human TMEM218, making it useful for comparative studies. Researchers can investigate species-specific differences in protein function and apply these insights to human disease mechanisms. The evolutionary conservation of TMEM218 across species supports its use as a model for human protein function .

Clinical Implications of TMEM218 Research

Research utilizing recombinant TMEM218 has significant clinical implications, particularly in understanding and potentially treating ciliopathies.

Ciliopathies Associated with TMEM218 Dysfunction

TMEM218 dysfunction has been linked to several ciliopathies:

  1. Senior-Løken Syndrome: Characterized by nephronophthisis and retinal degeneration, mirroring the phenotype observed in Tmem218−/− mice .

  2. Joubert Syndrome: A ciliopathy affecting brain development with features including cerebellar vermis hypoplasia and characteristic "molar tooth" appearance on MRI .

  3. Meckel Syndrome: A severe ciliopathy with features including encephalocele, polycystic kidneys, and polydactyly .

The association with these conditions highlights TMEM218's role in ciliary function and its importance in multiple organ systems during development and throughout life.

Therapeutic Potential

Understanding TMEM218's function through studies with recombinant proteins could potentially lead to novel therapeutic approaches for ciliopathies. While currently at the research stage, potential interventions might include:

  • Gene therapy approaches to restore TMEM218 function

  • Small molecule therapies targeting pathways affected by TMEM218 dysfunction

  • Cell-based therapies to replace affected tissues

Experimental Models and Disease Mechanisms

The Tmem218−/− mouse model has proven invaluable for understanding the pathophysiology of TMEM218-related disorders. This model exhibits both renal cysts and retinal degeneration, making it particularly useful for studying Senior-Løken syndrome . The gene-trapped allele (Tmem218Gt(OST40451)Lex) interrupts endogenous transcription within the 5' UTR, preventing proper protein expression.

Experimental data from these models has revealed several key insights:

  1. The disruption of normal TMEM218 expression leads to progressive renal cystic disease resembling nephronophthisis.

  2. Retinal degeneration becomes evident by 14 weeks of age in mouse models, with progressive thinning of the outer nuclear layer.

  3. β-galactosidase enzyme histochemistry in Tmem218−/− mice has identified TMEM218 expression in ciliated and flagellated cells, supporting its role in ciliary function .

These experimental findings provide a foundation for understanding the molecular mechanisms underlying TMEM218-related pathologies and for developing potential therapeutic interventions.

Future Directions in TMEM218 Research

Research on TMEM218 and its recombinant forms continues to evolve, with several promising avenues for future investigation:

Molecular Function Elucidation

Despite significant progress in understanding the consequences of TMEM218 deficiency, its precise molecular function remains incompletely characterized. Future research using recombinant bovine TMEM218 could help elucidate its specific role in ciliary biogenesis and function, potentially revealing new targets for therapeutic intervention.

Therapeutic Development

The Tmem218−/− mouse model provides an opportunity to test novel therapeutic approaches for related ciliopathies. As noted by researchers, "the Tmem218−/− mouse might be used in the development and testing of novel therapeutic approaches to the prevention and treatment of the renal and retinal ciliopathies seen in [Senior-Løken Syndrome]" .

Integration with Multi-Omics Approaches

Combining recombinant TMEM218 studies with genomics, proteomics, and metabolomics approaches could provide a more comprehensive understanding of the protein's function in normal development and disease states. This integrated approach might reveal previously unknown interactions and regulatory mechanisms.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preference for a particular tag, please inform us, and we will prioritize developing the specified tag.
Synonyms
TMEM218; Transmembrane protein 218
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM218
Target Protein Sequence
MAGTVLGVGAGVFVLALLWVSVLLLCALLFRASGAARFSVIFVFLGALIVTAILLLFPRA SDAPAPEAETKIVDAFFIGRYVLLAFLTAVFLGSLFLVLIHHILEPIYAKPLRSY
Uniprot No.

Target Background

Function
Recombinant Bovine Transmembrane protein 218 (TMEM218) may play a role in ciliary biogenesis or function.
Database Links
Protein Families
TMEM218 family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium.

Q&A

What is the basic structure and cellular localization of bovine TMEM218?

Bovine TMEM218 is a multi-pass transmembrane protein predominantly localized to primary cilia and cilia-related compartments. The protein contains multiple transmembrane domains that anchor it within the ciliary membrane. Structurally, it shares high sequence homology with human TMEM218, which functions as part of protein complexes in ciliary compartments. Immunofluorescence studies typically reveal TMEM218 localization patterns consistent with ciliary membrane distribution, often co-localizing with other ciliary markers.

Methodologically, researchers can visualize TMEM218 localization using confocal microscopy with antibodies specific to bovine TMEM218 or via expression of tagged recombinant protein (GFP-TMEM218) in bovine cell lines. When designing localization experiments, it's essential to include appropriate ciliary markers (such as acetylated α-tubulin) for co-localization studies .

Which protein interactions are known for bovine TMEM218?

While the complete interactome of bovine TMEM218 remains under investigation, research indicates that TMEM218 engages in protein-protein interactions critical for ciliary function. Based on homology with human TMEM218, the bovine variant likely interacts with components of the transition zone complex, including proteins involved in Joubert Syndrome and Meckel-Gruber Syndrome pathways.

Methodologically, researchers can investigate TMEM218 interactions through:

  • Co-immunoprecipitation assays using anti-TMEM218 antibodies

  • Proximity ligation assays in bovine cell models

  • Yeast two-hybrid screening with TMEM218 as bait

  • BioID or APEX2 proximity labeling approaches

When designing interaction experiments, consider that membrane protein interactions often require specialized conditions to maintain native conformation during extraction .

How does bovine TMEM218 compare to human TMEM218 in sequence and function?

Bovine TMEM218 shares approximately 85-90% sequence identity with human TMEM218, with highest conservation in the transmembrane domains. Functionally, both proteins are implicated in ciliary biology and appear to participate in similar molecular pathways.

To experimentally compare the two orthologs, researchers typically:

  • Perform rescue experiments in human cell lines with bovine TMEM218

  • Create chimeric proteins to identify functionally conserved domains

  • Conduct comparative interactome studies to identify species-specific binding partners

  • Analyze post-translational modification patterns between species

These comparative approaches help determine which functional aspects of TMEM218 are evolutionarily conserved versus species-specific .

What expression systems are most effective for producing recombinant bovine TMEM218?

Multiple expression systems have been utilized for bovine TMEM218 production, each with distinct advantages:

Expression SystemAdvantagesChallengesTypical Yield
E. coliRapid growth, low cost, high yieldPotential improper folding, lack of PTMs5-10 mg/L
Mammalian cells (HEK293)Native folding, appropriate PTMsHigher cost, longer production time1-5 mg/L
Insect cellsHigher yield than mammalian, some PTMsMedium complexity system3-8 mg/L

For optimal functional studies, mammalian expression systems (particularly HEK293) are preferred as they provide proper folding and post-translational modifications essential for TMEM218 function. For structural studies requiring higher yields, insect cell expression offers a good compromise between yield and proper protein folding.

The choice of purification tags (His, Avi, Fc) should be determined by downstream applications. His tags provide efficient purification but may interfere with certain protein interactions, while Fc-fusion proteins can enhance stability but introduce significant size to the construct .

What are the optimal conditions for purifying functional bovine TMEM218?

Purification of functional bovine TMEM218 requires careful optimization to maintain native structure:

  • Membrane extraction: Use mild detergents such as DDM (n-Dodecyl β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) at concentrations just above their critical micelle concentration

  • Buffer composition: Include stabilizing agents (glycerol 10-15%) and appropriate salt concentration (typically 150-300 mM NaCl)

  • pH range: Optimal activity is typically maintained between pH 7.0-8.0

  • Temperature: Perform all purification steps at 4°C to minimize protein degradation

A typical purification workflow involves:

  • Initial IMAC (immobilized metal affinity chromatography) for His-tagged proteins

  • Size exclusion chromatography to remove aggregates and ensure monodispersity

  • Optional ion exchange chromatography for increased purity

Critical quality control steps include Western blotting to confirm protein identity, dynamic light scattering to assess monodispersity, and functional assays to verify protein activity post-purification .

How is TMEM218 implicated in Joubert Syndrome and Meckel-Gruber Syndrome?

TMEM218 has been identified as a causative gene in ciliopathies, particularly Joubert Syndrome and Meckel-Gruber Syndrome. According to the CiliaMiner database, TMEM218 mutations are associated with specific clinical presentations:

For Joubert Syndrome, TMEM218 mutations correlate with:

  • Ataxia

  • Coloboma

  • Cystic kidney dysplasia

  • Eye anomalies

  • Respiratory insufficiency

  • Widely spaced or irregular teeth

For Meckel-Gruber Syndrome, TMEM218 mutations are associated with:

  • Anencephaly

  • Cystic kidney dysplasia

  • Occipital encephalocele

  • Polydactyly

  • Renal anomalies

Functionally, TMEM218 appears to work in concert with other ciliary proteins including TCTN3 and TXNDC15 in maintaining ciliary structure and function. Disruption of TMEM218 likely impairs ciliary signaling pathways critical for embryonic development .

How does TMEM218 interact with other ciliopathy-associated proteins in disease pathways?

TMEM218 functions within a network of ciliary proteins, with disruption of this network contributing to ciliopathy phenotypes. Key interactions include:

  • Transition zone components: TMEM218 interacts with transition zone proteins that regulate ciliary composition

  • TCTN complex: TMEM218 associates with the tectonic complex (including TCTN3) that controls ciliary membrane composition

  • IFT machinery: While not directly part of intraflagellar transport, TMEM218 function affects proper IFT protein localization

In the context of ciliopathies, mutations in TMEM218 potentially disrupt multiple protein interactions, as evidenced by shared disease genes between Joubert Syndrome and Meckel-Gruber Syndrome. The CiliaMiner database identifies several genes that function in overlapping pathways with TMEM218, including CEP290, TCTN3, and TXNDC15.

To experimentally investigate these interactions in disease contexts, researchers typically employ co-immunoprecipitation studies combined with mass spectrometry to identify altered protein interactions in wild-type versus mutant conditions .

What are the most reliable assays for measuring TMEM218 function in ciliary contexts?

Several complementary approaches are recommended for assessing TMEM218 function:

  • Ciliary morphology analysis:

    • Immunofluorescence microscopy to measure cilia length, frequency, and morphology

    • Scanning electron microscopy for detailed ultrastructural analysis

    • Live imaging with fluorescently tagged TMEM218 to track dynamics

  • Ciliary signaling assays:

    • Hedgehog pathway activity measurement using Gli transcription factor translocation

    • PDGF signaling assessment through receptor localization and downstream phosphorylation events

    • Calcium imaging to evaluate ciliary calcium signaling

  • Protein trafficking analysis:

    • FRAP (Fluorescence Recovery After Photobleaching) to measure protein dynamics

    • Selective permeabilization assays to distinguish ciliary vs. cytoplasmic protein pools

    • Super-resolution microscopy to precisely localize TMEM218 within ciliary subdomains

These assays should be performed in appropriate cellular contexts, such as serum-starved cells to induce ciliation, and include both gain-of-function and loss-of-function experimental designs .

How can researchers effectively analyze TMEM218 membrane topology and post-translational modifications?

Understanding TMEM218 topology and modifications requires specialized approaches:

  • Membrane topology analysis:

    • Protease protection assays using selectively permeabilized cells

    • Glycosylation mapping with N-glycosylation site mutations

    • SCAM (Substituted Cysteine Accessibility Method) to identify exposed residues

    • Cryo-EM structural analysis for high-resolution topology determination

  • Post-translational modification (PTM) mapping:

    • Mass spectrometry to identify modification sites (phosphorylation, ubiquitination, etc.)

    • Site-directed mutagenesis of putative modification sites to assess functional consequences

    • Phospho-specific or ubiquitin-specific antibodies to detect modifications

    • Pulse-chase experiments to determine modification dynamics

When performing these analyses, it's crucial to consider native cellular contexts, as membrane protein topology and modifications may differ between artificial and physiological environments .

How can TMEM218 be utilized in ciliary proteome mapping studies?

TMEM218 serves as a valuable tool for ciliary proteome investigations through several approaches:

  • BioID proximity labeling:

    • Generate TMEM218-BioID fusion proteins to biotinylate proximal proteins

    • After expression in bovine cells and streptavidin pulldown, identify biotinylated proteins by mass spectrometry

    • Compare wild-type vs. mutant TMEM218-BioID to identify mutation-specific changes in the local interactome

  • Comparative ciliary proteomics:

    • Use TMEM218 knockout or knockdown cells to identify changes in the ciliary proteome

    • Perform quantitative proteomics on isolated cilia from control vs. TMEM218-deficient cells

    • Integrate datasets with known ciliary protein databases (such as CiliaMiner) to identify novel components

  • Temporal interactome analysis:

    • Utilize inducible TMEM218 expression systems to capture dynamic interactions during ciliogenesis

    • Implement time-resolved proximity labeling to map changing protein interactions during ciliary assembly and disassembly

These approaches contribute to understanding broader ciliary biology beyond TMEM218's immediate function, potentially identifying novel therapeutic targets for ciliopathies .

What are the emerging techniques for studying TMEM218 dynamics in live cells?

Cutting-edge approaches for visualizing TMEM218 dynamics include:

  • Advanced imaging techniques:

    • Lattice light-sheet microscopy for extended live imaging with reduced phototoxicity

    • Single-molecule tracking to follow individual TMEM218 molecules within cilia

    • FRET-based biosensors to detect TMEM218 conformational changes or interactions

  • Optogenetic control:

    • Light-inducible dimerization systems to control TMEM218 interactions

    • Optogenetic recruitment of TMEM218 to specific ciliary domains

    • Photoswitchable fluorescent proteins to track specific subpopulations of TMEM218

  • Correlative light and electron microscopy (CLEM):

    • Combine live imaging of fluorescently tagged TMEM218 with subsequent electron microscopy

    • Precisely localize TMEM218 within ciliary ultrastructure at specific timepoints

These techniques enable researchers to move beyond static snapshots of TMEM218 localization and understand its dynamic behavior in functioning cilia. When implementing these approaches, careful optimization of tagging strategies is essential to avoid disrupting native protein function .

How do mutations in TMEM218 affect ciliary transition zone architecture and function?

Investigating the relationship between TMEM218 mutations and transition zone architecture requires sophisticated experimental approaches:

  • Structural analysis techniques:

    • Transmission electron microscopy of ciliary transition zones in TMEM218 mutant cells

    • Expansion microscopy to visualize transition zone protein organization at enhanced resolution

    • Cryo-electron tomography to resolve molecular details of transition zone architecture

  • Functional barrier assays:

    • Measure ciliary protein diffusion barriers using photoactivatable fluorescent proteins

    • Assess small molecule permeability into cilia using chemical sensors

    • Evaluate phosphoinositide distribution between ciliary and plasma membranes

  • Comparative mutational analysis:

    • Generate a panel of disease-associated TMEM218 mutations and assess their impact on transition zone structure

    • Perform rescue experiments with wild-type vs. mutant TMEM218 to identify critical functional domains

    • Correlate transition zone defects with specific clinical presentations in ciliopathy patients

Research suggests that TMEM218 mutations may disrupt the transition zone's function as a diffusion barrier, potentially explaining the molecular basis of associated ciliopathies. The precise mechanisms vary between mutations, potentially explaining the phenotypic heterogeneity observed in patients with TMEM218-related conditions .

How conserved is TMEM218 structure and function across mammalian species?

TMEM218 exhibits significant evolutionary conservation across mammalian species, reflecting its fundamental role in ciliary biology:

SpeciesSequence Identity to HumanConserved DomainsSpecies-Specific Features
Bovine~85-90%Transmembrane domains, C-terminal regionMinor variations in N-terminal sequence
Mouse~80-85%Transmembrane domains, C-terminal regionLonger linker between TM domains 2-3
Rat~80-85%Transmembrane domains, C-terminal regionSimilar to mouse variations
Zebrafish~65-70%Core transmembrane architectureMore divergent N- and C-termini

Comparative genomic approaches, including phylogenetic analysis and identification of conserved regulatory elements, provide insights into TMEM218 evolution and potentially identify critical functional regions under evolutionary constraint .

Can bovine models of TMEM218 function inform human ciliopathy research?

Bovine models offer several advantages for translational ciliopathy research:

  • Advantages of bovine systems:

    • Larger cell size facilitating certain imaging approaches

    • Availability of primary tissues and cells

    • Similar ciliary architecture to humans

    • Conserved ciliary signaling pathways

  • Translational approaches:

    • Generate bovine cell lines with human patient-specific TMEM218 mutations

    • Perform cross-species rescue experiments to test functional conservation

    • Develop organ-on-chip models using bovine cells to study tissue-specific ciliopathy manifestations

  • Considerations and limitations:

    • Species-specific differences in development and ciliary function

    • Variations in genetic background effects

    • Differences in ciliopathy phenotype penetrance

When designing translational studies, researchers should validate findings across multiple species models, ideally including patient-derived cells when available. The integrated analysis of bovine, mouse, and human data provides the most comprehensive understanding of TMEM218 function in ciliopathies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.