Recombinant Bovine Transmembrane protein 223 (TMEM223)

Shipped with Ice Packs
In Stock

Description

Introduction

Transmembrane protein 223 (TMEM223) is a protein associated with the mitochondrial ribosome that participates in the biogenesis of the cytochrome c oxidase complex (complex IV) . TMEM223, also known as C21orf33, is encoded by the TMEM223 gene . Research indicates that TMEM223 is crucial for maintaining appropriate physiological levels and interacts with the early stages of the cytochrome c oxidase biogenesis .

Protein Structure and Localization

TMEM223 has two transmembrane regions but lacks a distinct N-terminal targeting sequence . Within mitochondria, TMEM223 is an integral protein of the inner mitochondrial membrane (IMM), with its N- and C-termini oriented toward the mitochondrial matrix . Treatment with Proteinase K of mitoplasts resulted in a faster migrating C-terminal fragment of TMEM223, suggesting that the C-terminus is exposed to the mitochondrial matrix. TMEM223 is resistant to carbonate extraction, further confirming its location as an integral protein of the IMM .

3.1. Impact on Cytochrome c Oxidase

Studies using TMEM223 knockout cell lines have shown a reduction in the late assembling complex IV subunit COX6A, but not in the early complex IV constituent COX4-1 or the COX1 assembly factors C12ORF62 (COX14) and MITRAC12 (COA3) . Other OXPHOS complexes, such as complex I, complex II, and complex V, remained unaffected in these knockout cell lines. Additionally, knockout of TMEM223 led to an increase of RIESKE, a core protein of complex III .

3.2. Effects on Mitochondrial Translation

Experiments involving [35S]methionine labeling showed decreased levels of newly synthesized COX1 in TMEM223 knockout cells, while other mitochondrial-encoded proteins like COX2 and COX3 showed no significant differences . TMEM223's role in the first steps of cytochrome c oxidase biogenesis is also supported by these results .

3.3. Apoptotic Cell Death

Ectopic expression of wild-type (WT) and Parkinson’s disease (PD)-linked mutant TMEM230 in cultured cells induced apoptotic cell death. Mutant TMEM230 caused greater cell toxicity than WT TMEM230. Increased mitochondrial reactive oxygen species (ROS) levels, decreased cellular ATP, activated caspase 3/7, and increased poly(ADP-ribose) polymerase-1 (PARP1) cleavage were also caused by TMEM230 expression. Treatment with N-acetylcysteine (NAC) or Z-VAD-FMK significantly attenuated TMEM230-induced apoptosis in cultured cells and primary neurons .

3.4. Association with Parkinson's Disease

Mutations in the TMEM230 gene are associated with autosomal dominant Parkinson’s disease (PD) . TMEM230 is co-localized with synaptic vesicle trafficking-associated proteins, and its knockdown or expression of PD-linked mutants induces synaptic vesicle trafficking deficits and abnormalities in trans-Golgi network secretion . Mutant TMEM230 expression also increases $$ \alpha $$-synuclein levels and induces aggregates in SN4741 cells .

4.1. Quantification of BN-PAGE Analyses

ComplexConditionResult
IVTMEM223−/− cellsActivity of cytochrome c oxidase reduced to 62.5% of wild-type (WT)

4.2. Mitochondrial Protein Levels in TMEM223 Knockout Cells

ProteinComplexChange in TMEM223−/− Cells
COX6AIVReduced
COX4-1IVNot altered
C12ORF62IVNot altered
MITRAC12IVNot altered
NDUFA9INot altered
SDHAIINot altered
ATP5BVNot altered
RIESKEIIIIncreased

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TMEM223; Transmembrane protein 223
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM223
Target Protein Sequence
MAAPGRRWSVLLFRALQSLSARRALHDTAPPRDVLLFEHERGRFFAVLGLFCAGQGVFWA SLAIASLARPPTPVRPTDAKTPDHGGLDLRSTLWRYGLAVGCGAIGSLVLGAGLLFSLRS VRSVMLRAGGKQVTLTTHAPFGWGAHFTVPLNQVSCMAHRGEVPAMLPLKVKGRRFYFLL DKAGHFPNTKLFDNTVGAYRSL
Uniprot No.

Target Background

Database Links

KEGG: bta:616632

STRING: 9913.ENSBTAP00000012485

UniGene: Bt.7596

Protein Families
TMEM223 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and localization of TMEM223?

TMEM223 is an integral protein of the inner mitochondrial membrane (IMM) with two putative transmembrane spans. The protein lacks a defined N-terminal targeting sequence but demonstrates a specific topology with both N- and C-termini facing the mitochondrial matrix. When subjected to hypo-osmotic swelling and carbonate extraction experiments, TMEM223 displays resistance to carbonate extraction, confirming its status as an integral membrane protein rather than a peripheral membrane-associated protein. Proteinase K treatment of mitoplasts generates a faster-migrating C-terminal fragment, indicating that the C-terminus is exposed to the mitochondrial matrix and includes the second transmembrane domain and C-terminal region .

What expression systems are recommended for producing recombinant bovine TMEM223?

For recombinant expression of bovine TMEM223, mammalian cell-based expression systems such as HEK293 or CHO cells are most appropriate due to their ability to facilitate proper folding and post-translational modifications of membrane proteins. These systems can be transfected with expression vectors containing the bovine TMEM223 gene sequence using lipid-based transfection reagents or viral transduction methods. Expression can be confirmed using western blot analysis with antibodies directed against the C-terminus of the protein, similar to the approach used for detecting human TMEM223 . To optimize expression, consider using cell lines derived from bovine tissue to ensure species-compatible cellular machinery.

How can researchers confirm the purity and integrity of recombinant TMEM223?

Researchers can confirm the purity and integrity of recombinant TMEM223 through a combination of approaches:

  • SDS-PAGE followed by silver staining or western blot analysis using anti-TMEM223 antibodies

  • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to determine molecular weight and oligomeric state

  • Circular dichroism (CD) spectroscopy to assess secondary structure composition

  • Mass spectrometry for accurate molecular weight determination and sequence verification

Based on similar proteins analyzed with SEC-MALS, researchers should expect a monomeric protein with defined transmembrane helices . For western blot detection, using antibodies directed against the C-terminus provides reliable detection, as demonstrated in studies of human TMEM223 .

What functional roles does TMEM223 play in mitochondrial biogenesis?

TMEM223 plays a critical role in cytochrome c oxidase (complex IV) biogenesis based on knockout studies. In human cells, TMEM223 knockout results in:

  • Reduction of cytochrome c oxidase activity to approximately 62.5% of wild-type levels

  • Significant decrease in the synthesis of COX1, a mitochondrially-encoded subunit of complex IV

  • Reduced steady-state levels of late-assembling complex IV subunits like COX6A, while early components such as COX4-1 remain unaffected

These findings indicate that TMEM223 is specifically involved in the early stages of complex IV assembly, potentially by facilitating the translation of COX1 mRNA. TMEM223 has been identified as a mitochondrial ribosome-associated protein, suggesting it functions at the interface between mitochondrial translation and respiratory chain complex assembly .

While these findings are from human TMEM223 studies, bovine TMEM223 likely performs similar functions given the high conservation of mitochondrial processes across mammals.

How does TMEM223 interact with the mitochondrial ribosome?

TMEM223 has been identified as part of the interactome of the human mitochondrial ribosome. As an integral IMM protein with both termini facing the matrix, TMEM223 is positioned to interact with the mitochondrial translation machinery. This interaction likely occurs at the interface of the IMM and matrix, where TMEM223 can facilitate the co-translational insertion of newly synthesized mitochondrial-encoded proteins, particularly COX1, into the membrane .

The interaction appears to be functionally significant, as TMEM223 knockout leads to reduced COX1 synthesis (approximately 61.23% of normal levels as measured by [35S]methionine labeling). This suggests that TMEM223 may directly influence mitochondrial translation efficiency or specificity for certain transcripts .

Future research on bovine TMEM223 should include co-immunoprecipitation studies with mitochondrial ribosomal proteins to confirm and characterize these interactions in bovine systems.

What phenotypes are observed in TMEM223 knockout or knockdown models?

TMEM223 knockout models demonstrate several significant phenotypic changes:

  • Reduced cytochrome c oxidase (complex IV) activity (62.5% of wild-type levels)

  • Decreased synthesis of mitochondrially-encoded COX1 protein

  • Reduced steady-state levels of late-assembling complex IV subunits (e.g., COX6A)

  • Increased levels of RIESKE protein, a core component of complex III

  • Normal levels of other OXPHOS components including complex I (NDUFA9), complex II (SDHA), and complex V (ATP5B)

These observations indicate that TMEM223 deletion specifically impacts complex IV biogenesis without broadly affecting other respiratory chain complexes. The effect on complex IV activity was confirmed through both BN-PAGE analyses and colorimetric enzyme activity assays .

Interestingly, knockdown studies using siRNA showed comparable reductions in COX1 synthesis (61.23% of control levels), validating the knockout findings and indicating that the phenotype is directly linked to TMEM223 deficiency rather than compensatory mechanisms in the knockout line .

What are the recommended protocols for TMEM223 purification?

Purification of recombinant bovine TMEM223, as an integral membrane protein, requires specialized approaches:

  • Membrane Isolation: Begin with differential centrifugation to isolate mitochondria, followed by differential solubilization of the inner mitochondrial membrane using mild detergents like n-dodecyl β-D-maltoside (DDM) or digitonin.

  • Affinity Purification: Express TMEM223 with an affinity tag (His-tag or FLAG-tag) and purify using corresponding affinity chromatography. Position the tag at the C-terminus, which faces the mitochondrial matrix, to ensure accessibility.

  • Size Exclusion Chromatography: Perform SEC as a polishing step to separate monomeric TMEM223 from any aggregates or oligomers.

  • Quality Control: Assess purity using SDS-PAGE and western blotting with anti-TMEM223 antibodies. Confirm protein integrity through techniques like SEC-MALS to determine the molecular weight, which should be consistent with the theoretical size of bovine TMEM223 .

  • Activity Verification: Verify functionality through reconstitution into liposomes and assessment of interaction with mitochondrial ribosomal components.

Throughout the purification process, maintain detergent concentrations above the critical micelle concentration to prevent protein aggregation, and consider including phospholipids to stabilize the protein.

How can researchers generate and validate TMEM223 knockout models?

Based on successful approaches with human TMEM223, researchers can generate and validate bovine TMEM223 knockout models through the following methodology:

  • CRISPR/Cas9 Gene Editing:

    • Design guide RNAs targeting the bovine TMEM223 gene (similar to the approach used for human NM_001080501.3)

    • Transfect bovine cell lines with CRISPR/Cas9 constructs

    • Screen for genomic modifications using PCR and sequencing

  • Validation of Knockout:

    • Confirm genomic modification through sequencing to identify premature stop codons or frameshift mutations

    • Verify protein loss through western blot analysis of mitochondrial fractions using antibodies against bovine TMEM223

    • Assess mitochondrial protein steady-state levels, particularly OXPHOS components

  • Functional Characterization:

    • Measure cytochrome c oxidase activity using colorimetric assays

    • Perform [35S]methionine labeling to assess mitochondrial translation, particularly of COX1

    • Analyze respiratory chain complex assembly using blue native PAGE (BN-PAGE)

The successful human TMEM223 knockout approach generated premature stop codons at amino acids 36 and 38, providing a blueprint for bovine knockout design . Validation should demonstrate both the absence of TMEM223 protein and functional consequences on complex IV biogenesis and activity.

What experimental approaches can detect TMEM223 interactions with mitochondrial components?

To investigate TMEM223 interactions with mitochondrial components, researchers can employ several complementary approaches:

  • Co-immunoprecipitation (Co-IP):

    • Express tagged versions of bovine TMEM223 (FLAG, HA, or His-tag)

    • Solubilize mitochondrial membranes using mild detergents

    • Perform immunoprecipitation followed by mass spectrometry to identify interacting partners

    • Validate specific interactions through reciprocal Co-IP experiments

  • Proximity Labeling:

    • Generate fusion proteins of TMEM223 with BioID or APEX2

    • Express in bovine cells and activate the proximity labeling enzyme

    • Purify biotinylated proteins and identify by mass spectrometry

    • This approach can identify transient or weak interactions in the native cellular environment

  • Crosslinking Mass Spectrometry:

    • Treat intact mitochondria with membrane-permeable crosslinkers

    • Purify TMEM223 complexes and analyze by mass spectrometry

    • Identify crosslinked peptides to map interaction interfaces

  • Functional Assays:

    • Assess the impact of TMEM223 knockout/knockdown on mitochondrial ribosome function

    • Measure translation efficiency of specific mitochondrial mRNAs, particularly COX1

    • Conduct rescue experiments with wild-type vs. mutant TMEM223

Based on existing research, key interaction partners to investigate include mitochondrial ribosomal proteins and early assembly factors for complex IV biogenesis .

How does TMEM223 compare to other transmembrane proteins involved in mitochondrial translation?

TMEM223 belongs to a growing family of integral membrane proteins that facilitate mitochondrial gene expression and respiratory chain assembly. While several such proteins have been characterized, TMEM223 shows distinctive features:

ProteinMembrane LocalizationPrimary FunctionSpecific TargetsReference
TMEM223Inner mitochondrial membraneComplex IV biogenesisCOX1 translation
MITRAC12/COA3Inner mitochondrial membraneCOX1 assemblyEarly COX1 assembly
C12ORF62/COX14Inner mitochondrial membraneCOX1 assemblyEarly COX1 assembly
SMIM4Inner mitochondrial membraneComplex III biogenesisCytochrome b assembly

Unlike assembly factors that primarily function post-translationally, TMEM223 appears to be directly involved in the translational process of mitochondrial-encoded proteins, specifically COX1. This positions TMEM223 at the critical interface between translation and assembly processes in the mitochondria .

The unique position of TMEM223 in directly influencing translation efficiency makes it distinct from classical assembly factors and suggests a role in coordinating translation with membrane insertion and early assembly steps.

What experimental evidence supports TMEM223's role in complex IV biogenesis?

Multiple lines of experimental evidence establish TMEM223's role in complex IV biogenesis:

  • Knockout Phenotype Analysis:

    • TMEM223−/− cells show reduced cytochrome c oxidase activity (62.5% of wild-type levels)

    • BN-PAGE analysis reveals decreased assembled complex IV in knockout cells

    • Specific reduction in late-assembling subunit COX6A, while early complex IV components remain stable

  • Mitochondrial Translation Studies:

    • [35S]methionine labeling demonstrates specific reduction in COX1 synthesis in TMEM223−/− cells

    • Other mitochondrially-encoded proteins, including COX2 and COX3, show normal synthesis rates

    • siRNA-mediated depletion confirms translation defect, with COX1 synthesis reduced to 61.23%

  • Biochemical Localization:

    • Submitochondrial localization experiments position TMEM223 in the inner mitochondrial membrane

    • Resistance to carbonate extraction confirms its status as an integral membrane protein

    • Topological studies show both N- and C-termini facing the mitochondrial matrix

  • Protein Interactions:

    • Identification of TMEM223 in the mitochondrial ribosome interactome

    • Association with early assembly stages of complex IV biogenesis

These findings collectively establish TMEM223 as a mitochondrial inner membrane protein that promotes COX1 translation and is required for efficient complex IV assembly .

What potential applications exist for recombinant bovine TMEM223 in research?

Recombinant bovine TMEM223 offers several valuable applications for mitochondrial and cellular research:

  • Structural Biology:

    • Purified recombinant TMEM223 can enable structural determination through X-ray crystallography or cryo-electron microscopy

    • Structural insights would illuminate the mechanism of interaction with the mitochondrial ribosome

  • Protein Interaction Studies:

    • Recombinant TMEM223 can serve as bait in pull-down assays to identify species-specific interaction partners

    • Cross-species comparison between bovine and human interactors can reveal conserved mitochondrial translation mechanisms

  • In Vitro Translation Systems:

    • Incorporation of TMEM223 into reconstituted mitochondrial translation systems to enhance COX1 synthesis

    • Development of optimized cell-free systems for studying mitochondrial protein synthesis

  • Antibody Development:

    • Generation of high-quality antibodies against bovine TMEM223 for immunoprecipitation and localization studies

    • Useful tools for bovine mitochondrial research

  • Comparative Mitochondrial Biology:

    • Investigation of species-specific differences in mitochondrial translation and respiratory chain assembly

    • Understanding evolutionary conservation of TMEM223 function across mammalian species

Exploring these applications would contribute significantly to our understanding of mitochondrial biology and potential therapeutic approaches for mitochondrial disorders affecting respiratory chain function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.