Recombinant Bovine Transmembrane protein 229B (TMEM229B)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant bovine TMEM229B is produced using multiple systems:

ParameterSpecification
Host SystemsE. coli, yeast, baculovirus, mammalian cells
Purity≥85% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose; stable at -80°C
ReconstitutionRecommended in sterile water with 50% glycerol for long-term storage

Role in Male Fertility

A 2022 study linked TMEM229B to spermatogenesis in bovine hybrids (cattle-yak). Key findings include:

  • Downregulation: TMEM229B expression was significantly reduced in cattle-yak testes compared to purebred cattle, correlating with hybrid male infertility .

  • Regulatory Network: TMEM229B interacts with miRNAs (e.g., bta-miR-93) and genes involved in ATP binding, DNA repair, and MAPK signaling pathways .

Evolutionary Conservation

Orthologs of TMEM229B exist in zebrafish (tmem229b), mice (Tmem229b), and humans (TMEM229B), with 75–90% sequence similarity . Functional studies in zebrafish suggest roles in cellular senescence and cytokine signaling .

Applications in Research

Recombinant bovine TMEM229B is utilized in:

  • Antibody Development: Rabbit polyclonal antibodies (e.g., HPA046562) validated for ELISA and Western blot .

  • Gene Knockdown: Custom siRNA/shRNA reagents (e.g., MISSION esiRNA EHU056261) for functional studies .

  • Protein Interaction Studies: Used to map interactions with SMAD2, PIK3R1, and other signaling molecules .

Challenges and Future Directions

While TMEM229B’s exact biological function remains unclear, its conservation across species and association with critical pathways (e.g., MAPK, relaxin signaling) highlight its potential role in cellular communication and development . Future studies should prioritize in vivo models to elucidate its mechanisms in fertility and disease.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will do our best to fulfill it.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles should be avoided. Working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us and we will prioritize its inclusion during development.
Synonyms
TMEM229B; Transmembrane protein 229B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM229B
Target Protein Sequence
MASAEPLTALSRWYLYAIHGYFCEVMFTAAWEFVVNFNWKFPGVTSVWALFIYGTSILIV ERMYLRLRGRCPLLLRCLIYTLWTYLWEFTTGFILRQFNACPWDYSQFDFDFMGLITLEY AVPWFCGALLVEQFVIRNTLRLRFDKDAEPGEPSGALALANGHVKTD
Uniprot No.

Target Background

Database Links

KEGG: bta:536375

UniGene: Bt.64015

Protein Families
TMEM229 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM229B and what is its genomic location?

TMEM229B (Transmembrane Protein 229B) is a multi-pass membrane protein belonging to the TMEM protein family. In humans, the TMEM229B gene is located on chromosome 14 and was previously designated as C14orf83 (chromosome 14 open reading frame 83) . The protein features multiple transmembrane domains that span the lipid bilayer, with both cytoplasmic and extracellular portions. Unlike some other TMEM family members, TMEM229B's specific biological function remains incompletely characterized, though structural analysis suggests potential roles in membrane transport and signaling pathways.

What are the key structural characteristics of recombinant TMEM229B proteins?

Recombinant TMEM229B proteins typically contain multiple transmembrane domains that anchor the protein within cellular membranes. When produced for research applications, these proteins are often tagged (e.g., with C-Myc/DDK tags) to facilitate detection and purification . Commercially available recombinant human TMEM229B proteins are typically produced in mammalian expression systems such as HEK293T cells to ensure proper folding and post-translational modifications . The protein is typically formulated in a buffer solution containing components like Tris-HCl, glycine, and glycerol to maintain stability . For structural studies, researchers should consider that the transmembrane regions may influence protein folding and functionality in experimental systems.

How do genetic variations in TMEM229B potentially contribute to neurodegenerative disorders?

Interestingly, while TMEM229B locus was reported in earlier large-scale meta-analyses of GWAS studies to be associated with PD, subsequent studies have presented contradictory findings . The study by Chang et al. (2017) did not confirm this association, suggesting that TMEM229B's role in neurodegeneration may be more complex or population-specific . To date, functional studies elucidating TMEM229B's specific contributions to neuronal function or neurodegeneration remain limited, indicating a critical area for future research.

What methodological challenges exist when studying TMEM229B protein interactions with other cellular components?

Studying TMEM229B protein interactions presents several methodological challenges that researchers should address in their experimental design. First, as a transmembrane protein, TMEM229B contains hydrophobic domains that can complicate expression, purification, and interaction studies. Standard co-immunoprecipitation protocols may require optimization with specialized detergents to maintain protein solubility while preserving interaction interfaces.

Second, the relatively limited knowledge about TMEM229B's biological function makes it difficult to predict interaction partners, necessitating unbiased screening approaches such as proximity-dependent biotin identification (BioID) or yeast two-hybrid systems adapted for membrane proteins. For in vitro binding studies, researchers should consider using recombinant TMEM229B expressed in mammalian systems (such as HEK293T) rather than bacterial systems to ensure proper folding and post-translational modifications .

Finally, validating interactions in physiologically relevant contexts remains challenging due to the lack of well-characterized TMEM229B antibodies and cell models. Researchers should consider implementing multiple complementary techniques (e.g., FRET, BiFC, co-localization studies) to strengthen confidence in identified interactions.

How does bovine TMEM229B differ from human TMEM229B in terms of genetic variants and functional implications?

Comparative analysis of bovine and human TMEM229B reveals both structural conservation and species-specific variations that may influence protein function. While the core transmembrane topology appears conserved between species, differences in specific amino acid residues, particularly in cytoplasmic and extracellular domains, likely reflect evolutionary adaptations to species-specific cellular environments and interaction partners.

The functional implications of these interspecies differences remain largely unexplored. Human TMEM229B genetic variants have been studied primarily in the context of neurological disorders, with some loci potentially associated with Parkinson's Disease, though with inconsistent findings across different populations . In contrast, comprehensive analysis of bovine TMEM229B variants and their potential association with bovine neurological conditions remains limited in the current literature.

Researchers working with bovine models should exercise caution when extrapolating findings from human studies, particularly regarding genetic associations with disease. Cross-species functional studies employing both human and bovine TMEM229B variants in comparable experimental systems would provide valuable insights into conserved mechanisms versus species-specific functions.

What are the optimal conditions for expression and purification of recombinant bovine TMEM229B?

For optimal expression and purification of recombinant bovine TMEM229B, researchers should consider the following protocol adaptations:

Expression System Selection: Mammalian expression systems, particularly HEK293T cells, are preferable for transmembrane proteins like TMEM229B to ensure proper folding and post-translational modifications . While bacterial systems offer higher yields, they often produce misfolded membrane proteins.

Vector Design: Incorporate a signal peptide for proper membrane targeting and add affinity tags (such as C-Myc/DDK) for detection and purification . Position tags carefully to avoid interfering with transmembrane domains.

Culture Conditions:

  • Transfection: Lipid-based transfection reagents typically yield better results for transmembrane proteins

  • Temperature: Reduce to 30-32°C post-induction to improve proper folding

  • Induction time: Extend to 48-72 hours for mammalian systems

Purification Protocol:

  • Buffer composition: 25 mM Tris-HCl (pH 7.3), 100 mM glycine, 10% glycerol

  • Detergent selection: Mild non-ionic detergents (DDM, LMNG) preserve structure

  • Solubilization: Incremental detergent concentration gradient

  • Purification method: Two-step purification combining affinity chromatography and size exclusion

Storage Stability:

  • Store at -80°C in stabilizing buffer containing glycerol

  • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

Validation of properly folded protein using circular dichroism or limited proteolysis is recommended before functional studies.

How can researchers effectively analyze TMEM229B expression in different tissue samples?

Effective analysis of TMEM229B expression across tissue samples requires integrating multiple complementary techniques to overcome challenges associated with low abundance and transmembrane localization. Researchers should implement the following methodological approach:

Transcriptional Analysis:

  • qRT-PCR: Design primers spanning exon junctions unique to TMEM229B to avoid amplification of related family members

  • RNA-Seq: Employ sufficient sequencing depth (>40 million reads) with appropriate normalization for low-abundance transcripts

  • Single-cell RNA-Seq: Consider for heterogeneous tissues to identify cell type-specific expression patterns

Protein Detection:

  • Western Blot: Use membrane fraction enrichment protocols with appropriate detergents; validate antibody specificity against recombinant protein

  • Immunohistochemistry: Optimize antigen retrieval for membrane proteins; include both N and C-terminal targeted antibodies to confirm specificity

  • Mass Spectrometry: Implement specialized membrane protein extraction protocols and targeted approaches for low-abundance proteins

Reporter Systems:

  • For in vitro studies, construct TMEM229B-fluorescent protein fusions ensuring the tag doesn't disrupt membrane localization

  • For in vivo studies, consider CRISPR-mediated endogenous tagging to maintain physiological expression levels

When interpreting results, researchers should be aware that TMEM229B expression might not correlate directly with functional significance, as even low expression levels can be physiologically important in certain tissues or under specific conditions.

What cell-based assays are most appropriate for investigating TMEM229B function?

Investigating TMEM229B function requires specialized cell-based assays that account for its transmembrane localization and potential roles in cellular transport or signaling. Based on limited functional information and structural similarities to other TMEM family proteins, researchers should consider the following assay strategies:

Subcellular Localization Studies:

  • Fluorescent protein fusion imaging with co-localization markers for cellular compartments

  • Subcellular fractionation followed by Western blotting

  • Immunofluorescence with organelle-specific markers

Membrane Transport Assays:

  • Fluorescent substrate uptake/efflux measurements

  • Electrophysiological techniques for potential channel function

  • Radioligand transport assays for specific substrates

Protein Interaction Screens:

  • Membrane yeast two-hybrid systems

  • Proximity labeling approaches (BioID, APEX)

  • Co-immunoprecipitation with crosslinking for transient interactions

Loss-of-Function Studies:

  • CRISPR/Cas9-mediated knockout with phenotypic screening

  • siRNA/shRNA knockdown with rescue experiments using wild-type or mutant constructs

  • Dominant-negative mutant expression

Disease-Relevant Functional Assays:
Given the potential association with Parkinson's Disease , consider:

  • α-synuclein aggregation assays

  • Mitochondrial function assessment

  • Lysosomal function tests

  • Neurite outgrowth and neuronal survival assays

How should researchers interpret contradictory findings about TMEM229B's association with neurological disorders?

Interpreting contradictory findings regarding TMEM229B's association with neurological disorders requires a systematic analytical approach that considers multiple contributing factors:

Population Heterogeneity Analysis:
The association between TMEM229B loci and Parkinson's Disease has been inconsistent across studies, with some research supporting the connection and others failing to verify it . These discrepancies may reflect genuine population-specific genetic effects. Researchers should stratify analysis by:

  • Ethnic background (significant differences noted between Chinese cohorts and other populations)

  • Age of disease onset (early vs. late-onset Parkinson's Disease)

  • Clinical subtype classifications

  • Family history status (sporadic vs. familial cases)

Statistical Power Considerations:
Variation in cohort sizes significantly impacts the ability to detect associations with rare variants. The study by Nalls et al. (2014) identified TMEM229B association in a large-scale meta-analysis, while smaller studies may have been underpowered . Researchers should:

  • Calculate post-hoc power based on observed effect sizes

  • Consider Bayesian approaches for integrating evidence across studies

  • Pool data across compatible studies when possible

Methodological Differences:
Variations in sequencing technology, variant calling algorithms, and statistical methods contribute to discrepant results . Critical factors include:

  • Coverage depth differences between whole-exome vs. whole-genome sequencing

  • Filtering criteria for rare variants

  • Gene-based vs. variant-based statistical approaches

  • Different multiple testing correction strategies

Functional Context Integration:
Limited understanding of TMEM229B's biological function complicates interpretation of genetic associations. Until functional studies clearly establish TMEM229B's role in relevant pathways, genetic associations remain correlative rather than causative . Researchers should incorporate:

  • Pathway analysis to position TMEM229B within biological networks

  • Expression data from disease-relevant tissues

  • Animal model phenotypic data when available

When synthesizing contradictory findings, researchers should explicitly acknowledge limitations and avoid overinterpreting either positive or negative results until multiple independent studies in well-characterized populations provide consistent evidence.

What statistical approaches are most appropriate for analyzing TMEM229B genetic variants in case-control studies?

When analyzing TMEM229B genetic variants in case-control studies, researchers should implement a multi-tiered statistical framework tailored to the challenges of rare variant analysis and transmembrane protein genetics:

Variant Classification and Quality Control:

  • Implement strict quality filtering with depth thresholds ≥20× for reliable rare variant calling

  • Classify variants by predicted functional impact using algorithms like CADD (Combined Annotation Dependent Depletion) with thresholds ≥12.37 for damaging variants

  • Categorize variants as missense, damaging missense (Dmis), or loss-of-function (LoF) based on prediction algorithms

  • Apply minor allele frequency (MAF) thresholds (<1% and <0.1%) to define rare variants

Single-Variant Analysis:

  • For common variants: Implement allele-based logistic regression with covariates for age, sex, and population structure

  • For each variant, calculate odds ratios, 95% confidence intervals, and p-values

  • Apply appropriate multiple testing correction (Bonferroni or FDR)

  • Consider Bayesian approaches for variants with borderline significance

Gene-Based Burden Testing:

  • Implement collapsing methods that aggregate rare variants within TMEM229B

  • Apply burden tests such as SKAT, SKAT-O, or VT for different variant categories (all missense, Dmis only, Dmis+LoF)

  • Perform sensitivity analyses with different MAF thresholds (e.g., <1% vs. <0.1%)

  • Consider directional burden tests when prior functional information suggests consistent effect direction

Population Stratification Controls:

  • Incorporate principal components from genome-wide data as covariates

  • Conduct separate analyses in distinct ancestral groups before meta-analysis

  • Implement transmission disequilibrium tests in family-based designs when available

Power Calculations and Reporting:

  • Perform pre-study power calculations based on estimated effect sizes

  • Report minimum detectable effect sizes given actual sample size

  • Present complete statistical outputs including effect estimates, not just p-values

  • Publish negative findings to address publication bias

A comprehensive example from recent literature demonstrates this approach. In a Chinese PD cohort study, researchers analyzed TMEM229B variants using both single-variant and gene-based methods, finding no significant association with PD despite adequate sample size (3,879 patients and 2,931 controls) .

How can researchers effectively compare functional differences between wild-type and variant forms of TMEM229B?

Effectively comparing functional differences between wild-type and variant forms of TMEM229B requires a multi-dimensional experimental approach that addresses both structural and functional characteristics:

Structural Characterization:

  • Membrane topology analysis using cysteine accessibility or epitope insertion methods

  • Protein stability assessment through thermal shift assays adapted for membrane proteins

  • Sub-cellular localization comparison using confocal microscopy with quantitative co-localization metrics

  • Protein-protein interaction network mapping through proximity labeling followed by mass spectrometry

Functional Assessments:

  • Transport activity measurements for potential substrates based on cellular phenotypes

  • Electrophysiological recordings if channel function is suspected

  • Impact on cellular processes including autophagy, vesicular trafficking, and mitochondrial function

  • Rescue experiments in TMEM229B-knockout cellular models

Variant Selection Strategy:
Design a hierarchical variant testing approach:

  • Prioritize variants with highest predicted functional impact scores (CADD>20)

  • Include patient-specific variants identified in disease cohorts

  • Test evolutionary conserved sites across species

  • Include variants in different protein domains to map domain-specific functions

Readout Systems:

  • Develop quantitative cellular phenotypes that can detect subtle functional differences

  • Implement high-content imaging with machine learning-based phenotypic analysis

  • Consider reporter systems linked to suspected TMEM229B functions

Experimental Controls:

  • Include both positive controls (known deleterious variants) and negative controls (synonymous variants)

  • Test multiple variant alleles in parallel experimental batches

  • Validate key findings across multiple cell types including disease-relevant primary cells

Data Integration Framework:
Establish a scoring system that integrates multiple functional parameters:

  • Weighted impact scores based on assay relevance to disease mechanisms

  • Correlation analysis between functional metrics and clinical phenotypes when available

  • Systematic comparison with other TMEM family members showing similar structural features

Based on studies of related TMEM proteins, researchers should be particularly attentive to potential effects on vesicular trafficking, synaptic function, and mitochondrial dynamics, as these pathways have been implicated in TMEM230 function and Parkinson's Disease pathogenesis .

How does TMEM229B compare functionally to other members of the TMEM protein family implicated in neurological disorders?

TMEM229B belongs to a diverse family of transmembrane proteins with several members implicated in neurological disorders. Comparative functional analysis reveals both shared mechanisms and distinct pathways:

TMEM230:

  • Functional Role: Mutations cause autosomal dominant Parkinson's Disease (PD)

  • Molecular Mechanisms: Impairs synaptic vesicle trafficking, disrupts mitochondrial transport, and induces apoptotic cell death

  • Comparative Significance: Unlike TMEM230, TMEM229B's association with PD remains controversial, suggesting potentially distinct functional roles despite structural similarities

TMEM175:

  • Functional Role: Deficiency results in lysosomal and mitochondrial dysfunction and α-synuclein aggregation

  • Genetic Evidence: Contains a genome-wide significant locus (rs34311866) associated with PD

  • Structural Distinction: Functions as a lysosomal potassium channel, whereas TMEM229B's ion transport capabilities remain uncharacterized

TMEM163:

  • Expression Pattern: Highly expressed in cortex and cerebellum, with expression positively associated with PD risk

  • Genetic Evidence: Association with PD confirmed across multiple cohorts

  • Functional Connection: Like TMEM229B, located within known PD risk loci, suggesting potential involvement in shared pathways

TMEM108:

  • Clinical Association: Variant rs138073281 linked to cognitive progression in PD

  • Genetic Evidence: Rare missense variants suggestively associated with PD (P=0.014)

  • Comparative Relevance: Demonstrates how even TMEM proteins with subtle associations may contribute to disease subtypes

TMEM59:

  • Functional Significance: Overexpression in Drosophila PD model ameliorated shortened lifespan, impaired locomotor activity, and dopaminergic neuron loss

  • Molecular Mechanisms: Mediates autophagy and dopamine system regulation; interacts with TREM2 to regulate microglia function

  • Genetic Evidence: Significant enrichment of rare variants in familial and early-onset PD patients

This comparative analysis suggests that while several TMEM proteins converge on pathways relevant to neurodegeneration—including vesicular trafficking, mitochondrial function, and autophagy—their specific mechanisms and disease associations vary considerably. TMEM229B's functional role remains less characterized than other family members, presenting an important area for future investigation.

What novel methodological approaches might advance understanding of TMEM229B function?

Advancing understanding of TMEM229B function requires innovative methodological approaches that overcome current technical limitations in studying transmembrane proteins:

Advanced Imaging Technologies:

  • Super-resolution microscopy (STORM/PALM) to visualize TMEM229B distribution within membrane microdomains

  • Correlative light-electron microscopy (CLEM) to connect protein localization with ultrastructural context

  • Live-cell single-molecule tracking to monitor dynamic behavior and trafficking

CRISPR-Based Functional Genomics:

  • CRISPRi/CRISPRa screens targeting TMEM229B regulators and interactors

  • Base editing to introduce specific variants without disrupting gene architecture

  • Prime editing for precise modification of transmembrane domains

  • CRISPR-mediated endogenous tagging for physiological expression level studies

Structural Biology Innovations:

  • Cryo-electron microscopy optimized for membrane proteins

  • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • AlphaFold2 and RoseTTAFold predictions validated by experimental data

  • Lipid nanodisc reconstitution for functional studies in defined membrane environments

Spatial Transcriptomics and Proteomics:

  • Spatial transcriptomics to map TMEM229B expression in tissue context

  • Proximity-dependent biotinylation (BioID/TurboID) to identify compartment-specific interactors

  • Cross-linking mass spectrometry to capture transient protein-protein interactions

  • Targeted proteomics with parallel reaction monitoring for accurate quantification

Physiologically Relevant Model Systems:

  • Patient-derived induced pluripotent stem cells (iPSCs) differentiated to relevant cell types

  • Brain organoids to study TMEM229B in complex neural networks

  • Conditional knockout animal models with cell type-specific deletion

  • Humanized mouse models carrying human TMEM229B variants

Multi-Omics Integration Approaches:

  • Systems biology modeling incorporating proteomic, transcriptomic, and genetic data

  • Network analysis to position TMEM229B within cellular pathways

  • Machine learning approaches to predict functional consequences of variants

  • Comparative analysis across species to identify evolutionarily conserved functions

Implementation of these advanced methodologies would significantly enhance our understanding of TMEM229B biology, potentially revealing novel functions that connect this understudied protein to cellular pathways relevant to neurological disorders.

What are the key considerations for designing in vivo studies of TMEM229B function using animal models?

Designing rigorous in vivo studies of TMEM229B function using animal models requires careful consideration of multiple experimental dimensions:

Model Selection and Development:

  • Species selection: Consider evolutionary conservation of TMEM229B across species; mice share approximately 85% sequence identity with human TMEM229B, while bovine models may offer different advantages for comparative studies

  • Genetic modification approaches:

    • Conventional knockout for complete loss-of-function studies

    • Conditional knockout using Cre-lox systems for temporal/spatial control

    • Knock-in models expressing specific variants identified in human studies

    • Humanized models expressing the full human TMEM229B gene

Experimental Design Considerations:

  • Age-dependent phenotyping: Assess phenotypes at multiple timepoints (3, 6, 12, 18 months) to capture progressive changes

  • Sex-balanced cohorts: Include both male and female animals with sufficient sample sizes for sex-specific analyses

  • Environmental challenges: Incorporate stressors that might unmask subtle phenotypes

  • Cross-disciplinary phenotyping battery:

    • Behavioral assessment (motor, cognitive, social domains)

    • Physiological measurements

    • Molecular and cellular analyses of relevant tissues

Neurological Focus Areas:
Given the potential association of TMEM229B with Parkinson's Disease , prioritize:

  • Dopaminergic neuron quantification in substantia nigra pars compacta

  • α-synuclein aggregation assessment

  • Striatal dopamine level measurement

  • Motor function testing (rotarod, pole test, gait analysis)

  • Non-motor symptom evaluation (olfaction, gastrointestinal function, sleep)

Tissue-Specific Analyses:

  • Implement region-specific and cell type-specific analyses

  • Consider both central and peripheral nervous system tissues

  • Employ technological approaches including:

    • Single-cell RNA-seq for cell type-specific expression

    • Spatial transcriptomics for regional distribution

    • Synaptosomal preparation for synaptic enrichment

    • Multi-omics integration for comprehensive pathway analysis

Controls and Validation:

  • Include appropriate genetic background controls

  • Validate phenotypes across multiple independently generated lines

  • Perform rescue experiments to confirm specificity

  • Compare results with models of other TMEM family genes

Translation to Human Relevance:

  • Correlate findings with human genetic data

  • Test predictions in human cellular models

  • Focus on conserved pathways and mechanisms

  • Consider cross-species differences in interpreting results

This comprehensive framework for in vivo studies would significantly advance understanding of TMEM229B function while generating insights potentially relevant to neurological disorders associated with this protein family.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.