Recombinant Bovine Transmembrane protein 231 (TMEM231)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. To request a specific tag, please indicate your preference; we will prioritize fulfilling specified tag requests.
Synonyms
TMEM231; Transmembrane protein 231
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM231
Target Protein Sequence
MALYELFAHPVERGYRAGLCSKAALFLLLATALTYIPPLLVAFRSHGFWLKRSSYEEQPT VRFQHQVLLVALLGSEPGGFLAWSTFPAFNRLQEGHLRVPLVSAREEDRNQDGKMDMLHF KLELPLQSTEQVLGVQLILTFSYQLHRMSTFVMQSMAFLQSSFALPGSQLYVNGDLRLQQ KQPLGYGGLDVRYNVSVINGTSPFASDYDLTRIVAAYQERNVTTILTDPSPIWLVGRAAE APFVVNAVIRYPVEVISYLPGFWEMIKFAWIQYVSILLIFLWAFERIKRFVFQNQVVTTI PVTAMPQGELYKEHLS
Uniprot No.

Target Background

Function
TMEM231 is a transmembrane component of the tectonic-like complex, a structure localized at the transition zone of primary cilia. This complex acts as a barrier, preventing transmembrane protein diffusion between cilia and the plasma membrane. TMEM231 is essential for ciliogenesis and sonic hedgehog (SHH) signaling.
Database Links
Protein Families
TMEM231 family
Subcellular Location
Cell projection, cilium membrane; Multi-pass membrane protein.

Q&A

What is the fundamental structure of bovine TMEM231 and how does it compare to human and mouse orthologs?

Bovine TMEM231 is a two-pass transmembrane protein that shares significant structural homology with human and mouse orthologs. Like its orthologs, bovine TMEM231 is a critical component of the Meckel syndrome (MKS) complex that functions at the ciliary transition zone, positioned between the basal body and axoneme of cilia . The protein contains two membrane-spanning domains with both N- and C-terminal regions exposed to the cytoplasm. Sequence conservation analysis suggests that the functional domains are highly preserved across mammalian species, particularly in the transmembrane regions, which likely reflect their critical role in proper ciliary function .

What is the primary cellular function of bovine TMEM231?

Bovine TMEM231, similar to its orthologs in other species, plays a critical role in organizing the MKS complex at the ciliary transition zone. This organization is essential for controlling ciliary composition - specifically regulating which proteins can enter and remain within the cilium . Research shows that TMEM231 participates in:

  • Maintaining the diffusion barrier at the transition zone

  • Regulating localization of ciliary membrane proteins such as Arl13b and Inpp5e

  • Facilitating communication between the cilium and the cell body

  • Supporting proper ciliary signaling pathways, including Hedgehog signaling

The evolutionary conservation of these functions suggests their importance in bovine systems as well.

How does bovine TMEM231 interact with other components of the MKS complex?

Bovine TMEM231 interacts with multiple components of the MKS complex in a manner similar to what has been observed in other mammalian models. TMEM231 has been shown to interact directly with B9d1, and both proteins are reciprocally required for their localization to the transition zone . Additional interaction partners within the MKS complex include:

MKS Complex ComponentInteraction TypeFunction in Complex
B9d1Direct binding partnerRequired for reciprocal localization to TZ
Mks1Complex interactionStabilization of MKS complex assembly
Tctn1, Tctn2, Tctn3Complex componentsMembrane anchoring and organization
Cc2d2a (Mks6)Complex componentStructural organization of TZ
Tmem17Complex componentTZ organization
Tmem67 (Mks3)Complex componentCiliary membrane composition control

These interactions are critical for the assembly and function of the MKS complex at the transition zone . Disruption of bovine TMEM231 would likely destabilize the entire complex, affecting ciliary composition and function.

What is the expression pattern of TMEM231 in bovine tissues and how can it be detected?

While specific bovine expression data is limited, TMEM231's expression pattern is expected to parallel that of other mammals, with notable presence in ciliated tissues. Based on comparative analysis, researchers can anticipate expression in:

  • Renal tissues, particularly in the nephron epithelium

  • Hepatic tissues, especially biliary epithelium

  • Cerebral tissues, including the cerebellar region

  • Developing limb buds during embryogenesis

  • Other ciliated epithelial tissues throughout the body

For detection, researchers commonly employ:

  • Quantitative PCR using bovine-specific primers targeting TMEM231 transcripts

  • Western blotting with antibodies that cross-react with the conserved epitopes of TMEM231

  • Immunohistochemistry or immunofluorescence using validated antibodies in bovine tissue sections

What techniques are most effective for studying the subcellular localization of bovine TMEM231?

Several complementary approaches can be employed to accurately determine the subcellular localization of bovine TMEM231:

  • Immunofluorescence microscopy: Using specific antibodies against TMEM231 along with markers for cilia (acetylated tubulin), basal bodies (γ-tubulin), and the transition zone (other MKS components like B9d1). This technique is particularly effective for visualizing TMEM231's specific localization to the transition zone in fixed cells .

  • Live-cell imaging: Employing fluorescently tagged bovine TMEM231 constructs (GFP or LAP-tagged) to monitor localization in real-time. Care must be taken to ensure that tagging does not interfere with protein localization or function .

  • Immuno-electron microscopy: Providing nanometer-scale resolution to precisely localize TMEM231 at the transition zone ultrastructure in bovine ciliated cells.

  • Biochemical fractionation: Isolating cilia and transition zone fractions from bovine tissues or cultured cells to confirm TMEM231 enrichment in these structures through western blotting.

  • Proximity labeling: Using BioID or APEX2 fused to TMEM231 to identify proximal proteins in the native cellular environment, offering insights into its precise localization context .

How does ciliary localization of bovine TMEM231 change during cell cycle progression?

The dynamics of bovine TMEM231 localization likely follow patterns observed in other mammalian systems, with significant changes occurring during cell cycle progression:

  • G0/G1 phase: TMEM231 prominently localizes to the transition zone of primary cilia, which are fully formed during this phase.

  • S phase: As cells prepare to divide and cilia begin to be disassembled, TMEM231 gradually dissociates from the transition zone.

  • G2/M phase: TMEM231 is predominantly cytoplasmic or potentially associated with centrioles during mitosis when cilia are absent.

  • Cytokinesis/early G1: As daughter cells exit mitosis, TMEM231 begins to reassociate with the forming transition zone as ciliogenesis initiates.

Researchers tracking these dynamics should consider using:

  • Synchronized bovine cell cultures

  • Cell cycle markers (e.g., PCNA for S phase, phospho-histone H3 for M phase)

  • Live imaging with fluorescently tagged TMEM231 to capture real-time localization changes

What are the optimal conditions for expressing and purifying recombinant bovine TMEM231?

For successful expression and purification of recombinant bovine TMEM231, researchers should consider the following optimized protocol:

Expression System Options:

Expression SystemAdvantagesChallengesYield
E. coli (BL21)Cost-effective, rapidMay form inclusion bodies due to transmembrane domainsLow-moderate
Insect cells (Sf9, Hi5)Better folding of mammalian proteinsMore complex system, higher costModerate-high
Mammalian cells (HEK293, CHO)Native-like folding and modificationsMost expensive, time-consumingModerate

Recommended Protocol Elements:

  • Clone the bovine TMEM231 coding sequence into a vector containing an N-terminal tag (e.g., His6, GST, or FLAG) to aid purification

  • For mammalian expression, use codon-optimized synthetic gene in HEK293T cells

  • Include detergent screening (DDM, LMNG, GDN) during purification to maintain protein stability

  • Utilize affinity chromatography followed by size exclusion chromatography

  • Maintain protein stability with appropriate buffers containing glycerol and mild detergents

Key consideration: As a two-pass transmembrane protein, recombinant bovine TMEM231 requires detergent solubilization or nanodisc/liposome reconstitution to maintain native conformation .

What are the most reliable antibodies or detection methods for bovine TMEM231 in experimental settings?

When selecting detection methods for bovine TMEM231, researchers should consider the following options:

Antibody Options:

  • Cross-reactive antibodies: Some commercial antibodies raised against human or mouse TMEM231 may cross-react with bovine TMEM231 due to sequence conservation. Validation in bovine tissues is essential.

  • Custom antibodies: Consider developing custom polyclonal antibodies against unique bovine TMEM231 peptide sequences, particularly from the cytoplasmic domains which are more immunogenic than transmembrane regions.

Epitope Tags for Recombinant Expression:

  • LAP (Localization and Affinity Purification) tag system as described in research protocols

  • FLAG or V5 epitope tags positioned at the N-terminus to avoid disrupting transmembrane domains

Detection Methodologies:

  • Western blotting (reducing conditions, 10-12% SDS-PAGE)

  • Immunofluorescence (4% PFA fixation, 0.1% Triton X-100 permeabilization)

  • Co-immunoprecipitation studies with other MKS complex proteins such as B9d1

Validation steps should include knockout or knockdown controls, peptide competition assays, and recombinant protein controls to confirm specificity in bovine systems .

What gene editing approaches are most effective for studying bovine TMEM231 function?

Several gene editing approaches can be effectively employed to study bovine TMEM231 function:

CRISPR-Cas9 System:

  • Design gRNAs targeting early exons (particularly exon 2) of bovine TMEM231

  • Use paired nickase approach to reduce off-target effects

  • Confirm editing efficiency using T7E1 assay or next-generation sequencing

  • Create complete knockout or specific point mutations modeled after disease-associated variants (e.g., p.Asn90Ile, p.Pro125Ala)

RNAi Approaches:

  • shRNA constructs targeting conserved regions of bovine TMEM231 mRNA

  • siRNA transfection for transient knockdown studies

Rescue Experiments:

  • Express wild-type or mutant forms of TMEM231 in knockout backgrounds

  • Use conditional expression systems (Tet-On/Off) to study temporal requirements

Readouts for Functional Analysis:

  • Ciliary localization of membrane proteins (Arl13b, Inpp5e)

  • Assembly of MKS complex at the transition zone

  • Ciliary morphology and length measurements

  • Hedgehog signaling pathway activation

Research indicates that complete loss of TMEM231 in mice leads to embryonic lethality, suggesting that conditional approaches may be necessary for studying its function in specific bovine tissues or at defined developmental stages .

How does bovine TMEM231 contribute to ciliary transition zone formation and function?

Bovine TMEM231, like its orthologs, plays a critical role in the formation and function of the ciliary transition zone through several specific mechanisms:

  • Structural Organization: TMEM231 forms part of the molecular complex that constitutes the physical architecture of the transition zone. It works in concert with B9d1 and other MKS complex proteins to establish the characteristic Y-links that connect the axonemal microtubules to the ciliary membrane .

  • Diffusion Barrier Formation: TMEM231 contributes to establishing the selective permeability barrier at the ciliary base that controls protein entry and exit. This barrier function depends on proper interactions between TMEM231 and other transition zone proteins, including B9d1 and Mks1 .

  • Protein Complex Assembly Coordination: Research demonstrates that TMEM231 and B9d1 are reciprocally required for each other's localization to the transition zone. Additionally, they are essential for proper localization of other MKS components such as Mks1 and Tmem67 (Mks3) . This interdependence suggests that bovine TMEM231 serves as a critical organizer of the MKS complex assembly.

  • Ciliary Composition Regulation: Through its role in transition zone formation, TMEM231 controls which membrane proteins can enter the cilium. Studies in mouse models show that TMEM231 mutation disrupts localization of key ciliary proteins including Arl13b and Inpp5e , proteins essential for ciliary signaling functions.

  • Evolutionary Conservation: The functional importance of TMEM231 at the transition zone is underscored by its conserved role across species from C. elegans to mammals, suggesting essential functions in bovine systems as well .

What signaling pathways are affected by TMEM231 dysfunction in bovine cells?

Based on comparative studies in other mammalian systems, dysfunction of bovine TMEM231 would likely impact several critical signaling pathways:

Hedgehog (Hh) Signaling Pathway:

  • Primary disruption occurs due to mislocalization of key Hh pathway components from cilia

  • Results in aberrant Gli processing and transcriptional output

  • Critical for bovine embryonic development, particularly limb and neural patterning

Wnt/Planar Cell Polarity (PCP) Signaling:

  • Disturbed by altered ciliary composition and function

  • Affects convergent extension movements and tissue organization

  • Important for bovine embryonic morphogenesis

PDGF Signaling:

  • Receptor localization and activation within cilia is compromised

  • Impacts cellular proliferation and migration responses

  • Relevant for bovine tissue homeostasis and repair

mTOR Pathway Regulation:

  • Ciliary control of mTOR activity may be disrupted

  • Affects cellular growth, autophagy, and metabolism

  • Important for bovine cellular homeostasis

The phenotypic consequences observed in mouse models with TMEM231 mutations, including polydactyly, kidney cysts, and hepatic ductal plate malformations, reflect disruption of these signaling pathways and would likely manifest similarly in bovine systems with TMEM231 dysfunction .

How do mutations in bovine TMEM231 affect ciliary protein trafficking and composition?

Mutations in bovine TMEM231 would be expected to disrupt ciliary protein trafficking and composition through several mechanisms, based on studies of TMEM231 orthologs:

Impact on Membrane Protein Localization:
Research shows that TMEM231 mutations disrupt the localization of specific membrane-associated proteins to cilia, including:

  • Arl13b (a small GTPase essential for ciliary structure and Sonic hedgehog signaling)

  • Inpp5e (an inositol polyphosphate-5-phosphatase involved in phosphoinositide signaling)

Transition Zone Gating Function:
TMEM231 mutations compromise the transition zone's ability to function as a selective gate, resulting in:

  • Mislocalization of proteins that should be retained in cilia

  • Inappropriate entry of non-ciliary proteins into the ciliary compartment

  • Disrupted ciliary composition leading to signaling defects

Molecular Basis of Trafficking Defects:
The trafficking defects arise from disrupted MKS complex assembly at the transition zone. Studies show that disease-associated mutations in TMEM231 (such as p.Asn90Ile and p.Pro125Ala) fail to restore B9d1 localization to the transition zone, indicating compromised MKS complex formation .

Protein-Specific Effects:
Not all ciliary proteins are equally affected by TMEM231 dysfunction. The pattern of mislocalization depends on specific trafficking pathways and retention mechanisms for different ciliary cargo proteins, suggesting the involvement of TMEM231 in particular trafficking routes .

What disease phenotypes are associated with TMEM231 mutations in animal models?

Research in animal models, particularly mice, has revealed several consistent phenotypes associated with TMEM231 mutations that would likely parallel those in bovine models:

Embryonic Development:

  • Complete loss of TMEM231 on a C57BL/6 background causes embryonic lethality around E15.5

  • On mixed genetic backgrounds, embryos survive until birth but display severe developmental abnormalities

Kidney Abnormalities:

  • Development of polycystic kidneys, with cysts predominantly at the corticomedullary border

  • Progressive renal dysfunction similar to nephronophthisis pathology

Skeletal Abnormalities:

  • Preaxial polydactyly (extra digits)

  • Skeletal patterning defects consistent with Hedgehog signaling dysfunction

Hepatic Abnormalities:

  • Ductal plate malformations where the portal vein fails to separate from the bile duct

  • Impaired remodeling of the portal mesenchyme

Neural Development:

  • Microphthalmia (small eyes)

  • Potential neural tube defects (based on human disease correlations)

These phenotypes reflect the critical role of TMEM231 in ciliary function during development and tissue homeostasis, and would serve as important markers in any bovine model systems .

How can bovine TMEM231 research contribute to understanding human ciliopathies?

Bovine TMEM231 research offers several valuable contributions to understanding human ciliopathies:

Comparative Genomics and Evolution:

  • Studying the conserved and divergent features of TMEM231 across species provides insight into functionally critical domains

  • Bovine models represent an intermediate evolutionary distance between common laboratory animals and humans

Translational Disease Modeling:

  • Bovine organ systems, particularly kidneys, more closely resemble human systems in size and structure than mouse models

  • Ciliopathy manifestations in larger mammals may better recapitulate human disease progression and severity

Therapeutic Development Platform:

  • Bovine cell and tissue systems can serve as platforms for testing therapeutic approaches before human trials

  • Gene therapy or protein replacement strategies can be evaluated in a physiologically relevant large animal system

Research Advantages:

  • Availability of primary bovine kidney and liver cells for in vitro studies

  • Feasibility of obtaining embryonic tissues at different developmental stages

  • Potential for creating bovine organoid models of ciliopathy-affected tissues

Specific Research Applications:

Research AreaBovine AdvantageHuman Disease Relevance
Kidney ciliopathiesSimilar kidney structure and sizePolycystic kidney disease, nephronophthisis
Hepatic fibrosisComparable biliary systemCongenital hepatic fibrosis in MKS
Developmental patterningSimilar embryonic development timingOrofaciodigital syndromes, MKS
Drug metabolismMore similar to humans than rodentsPharmacological intervention testing

These attributes make bovine models valuable for bridging the translational gap between rodent studies and human ciliopathies .

What experimental approaches can distinguish between primary and secondary effects of TMEM231 dysfunction?

Distinguishing between primary (direct) and secondary (downstream) effects of TMEM231 dysfunction requires sophisticated experimental approaches:

Temporal Control Systems:

  • Inducible knockout/knockdown models: Using Cre-loxP or tetracycline-inducible systems to control when TMEM231 function is disrupted

  • Time-course analyses: Characterizing changes in cellular and molecular phenotypes at multiple timepoints after TMEM231 disruption

  • Rapid protein degradation systems: Employing auxin-inducible or dTAG degradation systems for acute TMEM231 protein depletion

Spatial Resolution Approaches:

  • Tissue-specific knockouts: Targeting TMEM231 disruption to specific bovine tissues to isolate local from systemic effects

  • Cell type-specific analyses: Single-cell transcriptomics to identify cell populations directly affected by TMEM231 loss

  • Subcellular protein localization: High-resolution imaging to track immediate changes in the transition zone architecture

Molecular Interaction Analyses:

  • Proximity labeling: BioID or APEX2 fused to TMEM231 to identify direct interaction partners

  • Crosslinking mass spectrometry: To capture direct molecular interactions of TMEM231

  • Mutational analysis: Creating specific mutations that disrupt individual protein interactions while preserving others

Pathway-Specific Readouts:

  • Ciliary protein localization: Distinguishing proteins directly dependent on TMEM231 for localization

  • Signaling pathway reporters: Using luciferase or fluorescent reporters to measure specific pathway activities

  • Rescue experiments: Testing whether downstream pathway activation can bypass TMEM231 dysfunction

Integration with Computational Approaches:

  • Network analysis to distinguish primary interaction hubs from secondary response networks

  • Causal inference methods applied to temporal gene expression data

These approaches collectively enable researchers to build causal models separating the direct functions of TMEM231 from the cascade of secondary effects that follow its dysfunction .

What are the best experimental controls for bovine TMEM231 functional studies?

To ensure rigorous and reproducible research on bovine TMEM231 function, researchers should implement the following experimental controls:

Genetic Controls:

  • Complete knockout: CRISPR-Cas9 generated TMEM231-null cells serve as negative controls for antibody specificity and functional studies

  • Rescue controls: Re-expression of wild-type bovine TMEM231 in knockout backgrounds confirms phenotype specificity

  • Domain mutants: Expression of specific functional domain mutants helps dissect domain-specific functions

  • Species ortholog controls: Human or mouse TMEM231 expression in bovine knockout cells tests functional conservation

Biochemical and Cellular Controls:

  • Subcellular fraction controls: Comparing ciliary, transition zone, and cytoplasmic fractions confirms proper localization

  • Interacting protein knockouts: B9d1 or Mks1 knockout cells help distinguish complex-dependent from independent functions

  • Ciliary induction controls: Serum starvation timing controls for variations in ciliogenesis efficiency

  • Cell cycle synchronization: Controls for cell cycle-dependent effects on cilia formation and TMEM231 localization

Technical Controls:

  • Antibody validation: Using epitope-tagged TMEM231 to validate antibody specificity

  • Multiple detection methods: Confirming results with complementary techniques (immunofluorescence, biochemical fractionation)

  • Multiple cell lines: Testing findings across different bovine cell types (kidney, fibroblast, etc.)

  • Dose-response experiments: When using inhibitors or inducible systems, establishing clear dose-response relationships

Experimental Implementation:

Experimental ApproachEssential ControlsPurpose
TMEM231 localization studiesCell type-matched TMEM231 knockout cellsValidate antibody specificity
Protein interaction studiesNegative control proteins of similar size/localizationConfirm interaction specificity
Ciliary composition analysisBasal body markers (γ-tubulin) and axonemal markers (acetylated tubulin)Distinguish transition zone-specific effects
Transition zone ultrastructureMultiple fixation protocolsEliminate fixation artifacts
Gene expression analysisMultiple reference genesEnsure normalization accuracy

Implementation of these controls ensures that observed phenotypes can be confidently attributed to specific aspects of TMEM231 function .

How can researchers effectively measure ciliary transition zone integrity in the context of TMEM231 studies?

Assessing ciliary transition zone integrity in bovine TMEM231 studies requires multi-faceted approaches that evaluate both structure and function:

Structural Assessment Methods:

  • Super-resolution microscopy:

    • Structured illumination microscopy (SIM) or stimulated emission depletion (STED) microscopy

    • Visualize transition zone proteins with nanometer precision

    • Measure the spatial organization of MKS complex components relative to TMEM231

  • Transmission electron microscopy (TEM):

    • Visualize Y-links connecting the axoneme to the ciliary membrane

    • Assess transition zone ultrastructure integrity

    • Quantify structural abnormalities in TMEM231-deficient cells

  • Correlative light and electron microscopy (CLEM):

    • Correlate fluorescently labeled transition zone proteins with ultrastructural features

    • Directly link molecular changes to structural alterations

  • Expansion microscopy:

    • Physical expansion of fixed samples for improved resolution of transition zone architecture

    • Compatible with standard confocal microscopy equipment

Functional Assessment Methods:

  • Ciliary protein localization analysis:

    • Quantitative immunofluorescence of key ciliary membrane proteins (Arl13b, Inpp5e)

    • Measure protein retention/exclusion at the transition zone boundary

    • Develop ciliary protein mislocalization indices

  • Diffusion barrier assays:

    • Fluorescence recovery after photobleaching (FRAP) of ciliary membrane proteins

    • Measure rates of protein exchange between ciliary and non-ciliary compartments

    • Quantify barrier integrity through diffusion kinetics

  • Ciliary import/export assays:

    • Live imaging of fluorescently tagged ciliary cargo proteins

    • Measure kinetics of protein transport across the transition zone

    • Compare import/export rates between wild-type and TMEM231-deficient cells

Molecular Composition Assessment:

  • Proximity proteomics:

    • TMEM231-BioID fusion to identify spatial proteome of the transition zone

    • Compare wild-type and mutant TMEM231 proximal protein profiles

    • Quantify changes in molecular composition at the transition zone

  • Co-immunoprecipitation coupled with mass spectrometry:

    • Quantify changes in MKS complex assembly

    • Identify alterations in protein-protein interactions at the transition zone

Quantification Approaches:

MeasurementMethodAnalysis Approach
TZ protein localizationFluorescence intensity profilesPeak intensity, width, and spacing measurements
Y-link integrityTEM analysisFrequency, angle, and length measurements
Diffusion barrier functionFRAPHalf-time recovery and mobile fraction calculations
Protein complex assemblyCo-IP/MSInteraction stoichiometry and affinity determination
Ciliary protein mislocalizationImmunofluorescenceCilium:cytoplasm intensity ratios

These complementary approaches provide robust assessment of transition zone integrity in the context of bovine TMEM231 functional studies .

What strategies can researchers use to integrate TMEM231 data with broader ciliopathy research?

Integrating bovine TMEM231 research with the broader ciliopathy field requires strategic approaches that connect specific findings to larger biological contexts:

Cross-Species Comparative Analysis:

  • Ortholog functional conservation: Systematically compare TMEM231 function across species (bovine, human, mouse, C. elegans)

  • Evolution of ciliary transition zones: Analyze taxonomic differences in TMEM231 sequence and interactome

  • Conservation mapping: Identify universally conserved vs. species-specific TMEM231 functions

Multi-Omics Integration:

  • Proteomics-transcriptomics correlation: Link TMEM231-dependent proteome changes to transcriptional responses

  • Metabolomics integration: Connect TMEM231 dysfunction to cellular metabolic alterations

  • Phosphoproteomics: Map signaling cascade changes downstream of TMEM231 disruption

Pathway and Network Analysis:

  • Protein interaction networks: Position TMEM231 within comprehensive ciliary protein interaction maps

  • Signaling pathway cross-talk: Identify intersections between TMEM231-regulated pathways and other ciliopathy-associated pathways

  • Gene ontology enrichment: Systematically categorize biological processes affected by TMEM231 dysfunction

Disease Phenotype Correlation:

  • Human-bovine phenotype mapping: Compare bovine TMEM231 dysfunction phenotypes with human ciliopathy manifestations

  • Mutation-phenotype correlations: Link specific TMEM231 mutations to distinct ciliopathy subtypes

  • Modifier gene identification: Identify genetic factors that modify TMEM231-associated phenotypes

Data Resources and Repositories:

Resource TypeExample RepositoriesIntegration Approach
Proteomics databasesCiliaCarta, CilDBMap bovine TMEM231 interactors to known ciliary proteins
Genetic resourcesOMIM, ClinVarConnect bovine findings to human disease variants
Expression databasesGEO, Expression AtlasCompare TMEM231 expression patterns across tissues and species
Imaging repositoriesCell Image LibraryContribute and compare ciliary transition zone morphologies
Model organism databasesMGI, WormBaseLink phenotypes across evolutionary distance

Collaborative Research Frameworks:

  • Standardized protocols: Adopt common experimental approaches for cross-lab comparison

  • Resource sharing: Develop and distribute validated reagents for bovine TMEM231 research

  • Pre-registration: Consider pre-registering experimental designs for key TMEM231 studies

  • Interdisciplinary collaboration: Engage developmental biologists, structural biologists, and clinicians

These integration strategies ensure that bovine TMEM231 research contributes maximally to the broader understanding of ciliary biology and ciliopathy disease mechanisms, while providing a solid foundation for translational applications .

What are the emerging technologies that could advance bovine TMEM231 research?

Several cutting-edge technologies show particular promise for advancing our understanding of bovine TMEM231 biology:

Advanced Genomic Engineering:

  • Base editing and prime editing: Precise introduction of specific TMEM231 mutations without double-strand breaks

  • CRISPR interference/activation (CRISPRi/a): Modulating TMEM231 expression without genetic modification

  • Multiplex CRISPR screening: Systematic analysis of genetic interactions with TMEM231

  • In vivo somatic editing: Tissue-specific TMEM231 modification in bovine models

Advanced Imaging Technologies:

  • Cryo-electron tomography: Visualize native transition zone architecture at molecular resolution

  • Lattice light-sheet microscopy: Capture dynamic events at the transition zone with minimal phototoxicity

  • Single-molecule tracking: Follow individual TMEM231 molecules in living cells

  • 4D imaging: Time-resolved 3D imaging of TMEM231 during ciliary assembly and disassembly

Spatial Omics Approaches:

  • Spatial transcriptomics: Map TMEM231-dependent gene expression with spatial resolution

  • Proximity proteomics with temporal control: Time-resolved mapping of TMEM231 interaction networks

  • Single-cell multi-omics: Correlate TMEM231 expression with proteomic and transcriptomic profiles at single-cell resolution

Structural Biology Innovations:

  • Cryo-EM of purified complexes: Resolve the structure of TMEM231 within the MKS complex

  • AlphaFold2 and structure prediction: Generate models of bovine TMEM231 structure and interactions

  • Integrative structural biology: Combine multiple structural techniques for complete models of TMEM231 complexes

Emerging Cell Biology Tools:

  • Organoid models: Develop bovine kidney, liver, and cerebral organoids to study TMEM231 in tissue context

  • Microfluidic ciliary function assays: High-throughput analysis of ciliary signaling in TMEM231 variants

  • Optogenetic control: Light-inducible modulation of TMEM231 function or localization

  • Tension sensors: Measure mechanical forces at the transition zone involving TMEM231

Technological Implementation Strategies:

TechnologyApplication to TMEM231Expected Insights
Cryo-ETTransition zone ultrastructureMolecular arrangement of TMEM231 within Y-links
Base editingIntroduction of disease-associated mutationsMutation-specific effects on transition zone function
Single-molecule trackingTMEM231 dynamicsMobility, residence time, and exchange rates at transition zone
Spatial transcriptomicsTissue context of TMEM231 functionRegional differences in TMEM231-dependent gene expression
AlphaFold2 modelingTMEM231 structure predictionMechanistic insights into TMEM231-B9d1 interactions

These emerging technologies offer unprecedented opportunities to address fundamental questions about bovine TMEM231 biology and connect these insights to human ciliopathy mechanisms .

What are the unresolved questions regarding TMEM231 function that require further investigation?

Despite significant advances in understanding TMEM231, several critical questions remain unresolved and warrant further investigation:

Structural Biology Questions:

  • What is the detailed atomic structure of TMEM231, and how do its transmembrane domains integrate into the ciliary membrane?

  • How does TMEM231 physically interact with B9d1 and other MKS complex components at the molecular level?

  • What conformational changes occur in TMEM231 during its assembly into the transition zone structure?

Molecular Function Questions:

  • Does TMEM231 directly interact with ciliary membrane proteins to regulate their localization, or does it act primarily as a structural scaffold?

  • What are the precise mechanisms by which TMEM231 contributes to the diffusion barrier at the transition zone?

  • Does TMEM231 have additional functions beyond its structural role in the MKS complex?

Regulatory Questions:

  • How is TMEM231 expression and localization regulated during development and in different tissue contexts?

  • What post-translational modifications occur on TMEM231, and how do they affect its function?

  • How does TMEM231 respond to cellular stress or ciliary damage?

Disease Mechanism Questions:

  • Why do different mutations in TMEM231 lead to distinct ciliopathy phenotypes (OFD3 vs. MKS)?

  • Are there tissue-specific requirements for TMEM231 function that explain the organ-specific manifestations of TMEM231 mutations?

  • What is the relationship between TMEM231 dysfunction and the progressive nature of some ciliopathy phenotypes?

Evolutionary Biology Questions:

  • How has TMEM231 function evolved across species, and what aspects are uniquely important in larger mammals like bovines?

  • Are there species-specific interaction partners for TMEM231 that confer specialized functions?

Therapeutic Development Questions:

  • Can TMEM231 function be restored in mutant cells through chemical modulation or protein replacement strategies?

  • Are there bypass mechanisms that could compensate for TMEM231 loss in ciliopathy contexts?

These unresolved questions represent important frontiers in TMEM231 research, with implications for both basic ciliary biology and translational ciliopathy research .

How might therapeutic approaches targeting TMEM231 dysfunction be developed and tested?

Developing therapeutic strategies for TMEM231-related dysfunctions requires a multi-faceted approach spanning from basic mechanistic understanding to translational applications:

Gene Therapy Approaches:

  • AAV-mediated gene replacement: Delivery of functional TMEM231 using tissue-specific promoters

  • CRISPR-based gene correction: Precise editing of disease-causing mutations in TMEM231

  • mRNA therapy: Transient expression of TMEM231 mRNA to restore protein levels

  • Antisense oligonucleotides: Correction of splicing defects in TMEM231 variants that affect mRNA processing

Small Molecule Strategies:

  • Protein stabilization: Development of small molecules that stabilize mutant TMEM231 proteins (similar to CFTR modulators for cystic fibrosis)

  • Transition zone modulation: Compounds that enhance remaining transition zone function despite TMEM231 deficiency

  • Pathway-specific modulators: Targeting downstream pathways affected by TMEM231 dysfunction (e.g., Hedgehog pathway modulators)

  • Proteostasis regulators: Enhancing cellular quality control mechanisms to improve mutant TMEM231 folding

Protein/Peptide Therapeutics:

  • Cell-penetrating peptides: Delivery of functional TMEM231 domains to the transition zone

  • Engineered protein scaffolds: Artificial replacements for TMEM231 function at the transition zone

  • Nanobody-based approaches: Targeted modulation of transition zone components to compensate for TMEM231 loss

Testing Platforms:

Testing PlatformAdvantagesApplications
Patient-derived iPSCsDisease-relevant genetic backgroundInitial efficacy testing, personalized approaches
Bovine cell modelsSimilar physiology to humansPre-clinical validation, dose-finding
Organoid systems3D tissue architectureTissue-specific efficacy, off-target effects
TMEM231 knockout miceIn vivo systemic effectsPharmacokinetics, long-term efficacy
High-throughput phenotypic screensLarge compound librariesNovel therapeutic discovery

Development Pathway:

  • Target validation: Confirm which aspects of TMEM231 function are critical to restore in specific disease contexts

  • Mechanism-based screening: Develop assays that specifically measure transition zone integrity and function

  • Lead optimization: Focus on tissue-specific delivery and minimizing off-target effects

  • Combination approaches: Consider targeting multiple transition zone components simultaneously

  • Biomarker development: Identify measurable indicators of therapeutic efficacy in accessible samples

Therapeutic Challenges:

  • Addressing tissue-specific requirements for TMEM231 function

  • Timing interventions appropriately during development for congenital disorders

  • Achieving sufficient therapeutic levels at the ciliary transition zone

  • Compensating for complex protein interactions that may not be restored by single protein replacement

These therapeutic development strategies represent promising avenues for addressing TMEM231-related ciliopathies, though each approach presents unique challenges that require careful consideration in preclinical and clinical development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.