Recombinant Bovine Transmembrane protein 234 (TMEM234)

Shipped with Ice Packs
In Stock

Description

Introduction

Transmembrane protein 234 (TMEM234) is a protein-coding gene that, in humans, may be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay . Orthologs of TMEM234 are found in species such as Bos taurus (bovine), Chlorocebus sabaeus (green monkey), and Heterocephalus glaber (naked mole-rat) .

Expression and Function

The precise function of TMEM234 in bovines and other species is not yet fully understood. Studies using rat models provide some insights. Gene expression studies in Danio rerio (zebrafish) have shown both positive and negative correlations with other genes, as detailed in the table below .

Table 1: Correlated Gene Expression in Danio rerio

Positive CorrelationNegative Correlation
GenerGener
cldne0.113marcksb-0.062
si:dkey-87o1.20.113hmgb1b-0.061
spint20.111si:dkey-56m19.5-0.057
cldnb0.108si:ch211-288g17.3-0.056
si:ch211-195b11.30.108hmgb3a-0.054
tmem176l.40.108hnrnpa0a-0.054
cd9b0.107nova2-0.052
nqo10.106nucks1a-0.051
scel0.106tuba1a-0.051
selenow2b0.106chd4a-0.050

Role in Biological Pathways

Research indicates that TMEM234 may play a role in various biological pathways. An epigenome and transcriptome analysis has clarified the impact of lncRNAs on gastrointestinal stromal tumors . Transcriptome data from GIST-T1 cells were obtained through microarray analysis . Among a total of 23462 H3K4me3 peaks detected with ChIP-seq, the majority (62.7%) were located within gene promoter regions . Gene expression levels were tightly correlated with enrichment of H3K4me3 at TSS regions .

Genetic Variations

The Rat Genome Database reports several variants in the Tmem234 gene . These variations may influence gene expression, protein function, and ultimately, phenotypic traits.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM234; Transmembrane protein 234
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM234
Target Protein Sequence
MAATLGQVLALVLVAALWGGTQPLLKRASSRLQQVHERTWARQLLQEMKTLFLNPEYLMP FSLNQCGSLLYYLTLASTDLTLAVPISNSLAIIFTLIVGKVLGEDIGGKRAFAGMVLTVA GITLCITSSVTKTQGQPSAL
Uniprot No.

Target Background

Database Links

KEGG: bta:100126052

UniGene: Bt.11076

Protein Families
TMEM234 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the predicted structure of bovine TMEM234?

TMEM234 is predicted to be a membrane-associated protein with a hairpin structure, with both C- and N-terminal parts extending toward the extracellular space . It contains multiple transmembrane helices that anchor it within the cell membrane, consistent with its classification as an SLC-like protein meeting the structural criterion of having at least three transmembrane helices . For recombinant expression, this structural arrangement necessitates careful consideration of expression systems that can properly fold these transmembrane domains.

What is the cellular localization of TMEM234 in kidney tissue?

In kidney tissue, TMEM234 is strongly expressed by podocytes where it localizes specifically to podocyte foot processes . Immunofluorescence studies have shown overlapping reactivity between TMEM234 and nephrin, a well-established foot process marker . During podocyte development, TMEM234 has been observed at the basal aspects of prepodocytes and not between cells where developing slit diaphragms are found, suggesting it is a component of the basal plasma membrane domain of podocytes rather than being associated with intercellular junctions .

What functional domains are present in TMEM234?

TMEM234 contains a corresponding "TMEM234" Pfam domain, which is a member of the Drug/Metabolite Transporter (DMT) superfamily . This classification suggests potential transporter functionality, although direct transport studies with recombinant TMEM234 have not been reported in the available literature. When designing expression constructs for recombinant bovine TMEM234, researchers should ensure these functional domains remain intact to preserve native activity.

What expression systems are recommended for recombinant bovine TMEM234?

For recombinant expression of bovine TMEM234, mammalian expression systems are typically preferred due to the protein's multiple transmembrane domains and potential post-translational modifications. HEK293 or CHO cells are commonly used for membrane proteins with complex topologies. For efficient expression, consider using strong promoters like CMV and incorporating a cleavable signal peptide to ensure proper membrane targeting. Expression vectors should include epitope tags (such as His6, FLAG, or HA) positioned to avoid disrupting transmembrane domains or functional regions.

What are the key considerations for purifying recombinant bovine TMEM234?

Purification of recombinant bovine TMEM234 requires careful consideration of detergent selection to maintain protein stability and function. Initial solubilization typically employs mild detergents such as DDM (n-dodecyl-β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol). A two-step purification approach is recommended: first using affinity chromatography based on incorporated tags, followed by size exclusion chromatography to isolate homogeneous protein populations. Throughout purification, maintaining a physiologically relevant buffer containing stabilizing agents like glycerol (10-15%) and potentially specific lipids may help preserve native conformation.

How can researchers verify the proper folding of recombinant bovine TMEM234?

Verification of proper folding is crucial for functional studies of recombinant bovine TMEM234. Circular dichroism (CD) spectroscopy can assess secondary structure elements, particularly important for confirming the presence of predicted alpha-helical transmembrane segments. Thermal stability assays using differential scanning fluorimetry provide insights into protein stability. Additionally, functional verification through binding assays or, where possible, reconstitution into liposomes for functional assays would provide the strongest evidence of proper folding. For bovine TMEM234, comparing localization patterns of the recombinant protein with native expression patterns in kidney tissue can provide additional confirmation.

What assays can demonstrate the functional integrity of recombinant bovine TMEM234?

Based on zebrafish studies showing that TMEM234 is essential for glomerular filtration barrier function, researchers can assess functional integrity through:

  • Cell adhesion assays: As TMEM234 may be involved in podocyte GBM adhesion , measuring adhesion strength of cells expressing recombinant bovine TMEM234 to extracellular matrix components.

  • Protein-protein interaction studies: Pull-down assays or co-immunoprecipitation to identify binding partners, particularly components of the glomerular basement membrane or cell adhesion complexes.

  • Reconstitution systems: Incorporation of purified recombinant bovine TMEM234 into artificial membrane systems to assess membrane integration and potential transport functions.

  • Cellular localization: Confirming proper localization to the basal membrane in polarized cell culture models.

How can researchers determine if bovine TMEM234 has solute carrier-like transport activity?

Given TMEM234's classification in relation to solute carrier-like proteins , researchers might investigate potential transport activity using:

  • Vesicle-based transport assays: Reconstitute recombinant bovine TMEM234 into proteoliposomes and measure the uptake of radiolabeled or fluorescently labeled potential substrates.

  • Whole-cell uptake studies: Express recombinant bovine TMEM234 in cell lines with low background transport activity and measure substrate uptake compared to control cells.

  • Electrophysiological approaches: If ion transport is suspected, patch-clamp electrophysiology can measure ion currents in cells expressing recombinant bovine TMEM234.

  • Fluorescence-based flux assays: Using pH-sensitive or ion-sensitive fluorescent dyes to monitor changes in cellular compartments containing expressed recombinant bovine TMEM234.

What cell models best replicate the native environment for bovine TMEM234 functional studies?

For functional studies of recombinant bovine TMEM234, podocyte cell lines provide the most physiologically relevant environment given the protein's natural expression pattern . Conditionally immortalized podocyte cell lines that can be differentiated to express foot processes are particularly valuable. These models allow researchers to assess TMEM234's role in maintaining podocyte morphology, adhesion to the basement membrane, and response to injury stimuli. For comparative studies, both human and bovine podocyte cell lines would be informative, with human cells offering translational relevance and bovine cells providing species-matched context.

How conserved is TMEM234 between bovine and other mammalian species?

Cross-species rescue experiments between mouse and zebrafish Tmem234 have demonstrated that the function of TMEM234 protein is conserved between these species . This suggests evolutionary conservation of TMEM234 function across vertebrates, making bovine TMEM234 potentially relevant for comparative studies. When designing experiments with recombinant bovine TMEM234, researchers should consider sequence alignment with human and mouse orthologs to identify conserved domains likely crucial for function. Sequence divergence in specific regions might reflect species-specific adaptations that could influence experimental outcomes when using the bovine protein in heterologous systems.

What are the key differences in TMEM234 expression patterns between bovine and human tissues?

While the provided search results don't directly compare bovine and human TMEM234 expression patterns, human TMEM234 shows strong glomerular immunoreactivity with only weak signals detected in the rest of the kidney . For bovine-specific expression patterns, targeted studies would be necessary. When working with recombinant bovine TMEM234, researchers should consider potential differences in tissue distribution that might affect the interpretation of results, particularly in translational studies. Comparative immunohistochemistry using species-specific antibodies would be valuable for establishing these differences.

How can species-specific post-translational modifications affect recombinant bovine TMEM234 studies?

Post-translational modifications (PTMs) can significantly impact membrane protein function and interactions. For recombinant bovine TMEM234, researchers should:

  • Analyze predicted PTM sites (glycosylation, phosphorylation, etc.) in bovine versus target experimental species

  • Consider expression systems that recapitulate relevant PTMs

  • Validate PTM status of purified recombinant protein using mass spectrometry

  • Assess the functional impact of PTMs through site-directed mutagenesis of predicted modification sites

These considerations are particularly important when using recombinant bovine TMEM234 in human cell systems for disease modeling or drug discovery applications.

What are the most effective methods for TMEM234 gene silencing in cell culture models?

For TMEM234 gene silencing in cell culture models, researchers have several options:

  • siRNA transfection: Provides transient knockdown; design multiple siRNAs targeting different regions of bovine TMEM234 mRNA

  • shRNA stable expression: For longer-term studies; select targets based on siRNA validation results

  • CRISPR/Cas9 genome editing: For complete knockout; design guide RNAs targeting early exons of bovine TMEM234

Validation of knockdown/knockout should include both mRNA (qPCR) and protein (Western blot) assessment. When studying bovine TMEM234, the approach used in zebrafish studies with morpholinos targeting different regions of Tmem234 (I1E2 and E1I1) provides a methodological template . The dual-targeting approach helps confirm phenotype specificity.

What phenotypic changes should researchers anticipate in TMEM234 knockout/knockdown experiments?

Based on zebrafish Tmem234 knockdown studies, researchers should anticipate the following phenotypic changes:

  • Cellular level: Foot process effacement in podocytes (observable by electron microscopy)

  • Tissue level: Disorganization of glomerular structure

  • Functional level: Compromised filtration barrier integrity, potentially resulting in proteinuria

  • Molecular level: Potential downregulation of other podocyte-specific markers

For in vitro work with bovine podocytes, changes in cell adhesion, morphology, and response to mechanical or chemical stress would be important endpoints. Rescue experiments with wild-type recombinant bovine TMEM234 can confirm specificity, as demonstrated in the zebrafish model .

How can researchers design effective rescue experiments with recombinant bovine TMEM234?

Effective rescue experiments with recombinant bovine TMEM234 require careful consideration of several factors:

  • Expression timing: Introduce recombinant protein at appropriate developmental stages or time points after knockdown/knockout

  • Expression levels: Titrate expression to approximate physiological levels

  • Subcellular targeting: Ensure proper trafficking to the basal membrane domain

  • Functional verification: Include positive controls for protein activity

  • Mutant controls: Include non-functional TMEM234 variants as negative controls

The zebrafish study demonstrating rescue of Tmem234 morphants with mouse Tmem234 mRNA provides a methodological framework . For cell culture models, lentiviral delivery of codon-optimized TMEM234 resistant to the knockdown construct would allow stable rescue expression.

What challenges exist in determining the high-resolution structure of bovine TMEM234?

Determining the high-resolution structure of bovine TMEM234 faces several challenges inherent to membrane proteins:

  • Expression and purification obstacles: Membrane proteins often express poorly and require detergents for solubilization that can alter native conformation

  • Conformational heterogeneity: Membrane proteins typically adopt multiple conformations related to their function

  • Crystallization difficulties: Detergent micelles surrounding the protein complicate crystal contacts

  • Size limitations for NMR: The molecular weight of TMEM234 with surrounding detergent/lipid may exceed practical limits

Researchers might overcome these challenges through:

  • Systematic screening of expression constructs with varying tags and fusion partners

  • Detergent screening guided by stability assays

  • Consideration of newer approaches like cryo-electron microscopy which has fewer size limitations

  • Lipid cubic phase crystallization specifically designed for membrane proteins

What computational approaches can predict structure-function relationships in bovine TMEM234?

With limited experimental structural data available for TMEM234, computational approaches offer valuable insights:

  • Homology modeling: Using related proteins with known structures as templates

  • Ab initio modeling: For unique regions without suitable templates

  • Molecular dynamics simulations: To explore conformational dynamics in membrane environments

  • Evolutionary coupling analysis: To identify co-evolving residues likely to be in contact

  • Ligand docking: To predict potential binding sites if transport function is suspected

For bovine TMEM234, comparative modeling based on related members of the Drug/Metabolite Transporter superfamily could provide initial structural hypotheses that guide experimental design. These models should be validated against biochemical data before use in further analyses.

How can hydrogen-deuterium exchange mass spectrometry inform bovine TMEM234 structure-function studies?

Hydrogen-deuterium exchange mass spectrometry (HDX-MS) provides valuable information about protein dynamics and solvent accessibility without requiring crystallization. For recombinant bovine TMEM234, HDX-MS can:

  • Identify solvent-exposed regions versus membrane-embedded domains

  • Map conformational changes upon substrate binding or protein-protein interactions

  • Detect regions with altered dynamics in disease-associated mutations

  • Complement computational models by providing experimental validation

The experimental setup would require optimized detergent conditions for maintaining TMEM234 stability while allowing efficient deuterium exchange. Data interpretation should account for the slower exchange rates typically observed in transmembrane regions due to hydrogen bonding within alpha-helices and limited solvent accessibility.

What kidney pathologies might involve bovine TMEM234 dysfunction based on current knowledge?

Based on zebrafish knockdown studies showing that Tmem234 deficiency leads to foot process effacement and compromised filtration barrier , several kidney pathologies might involve TMEM234 dysfunction:

  • Proteinuric kidney diseases: Conditions characterized by protein leakage across the glomerular filtration barrier

  • Podocytopathies: Diseases primarily affecting podocyte structure and function

  • Focal segmental glomerulosclerosis (FSGS): Characterized by podocyte injury and foot process effacement

  • Minimal change disease (MCD): Features podocyte foot process effacement without visible glomerular lesions

The proposed role of TMEM234 in podocyte-GBM adhesion suggests it could be particularly relevant in diseases where this interaction is compromised. Studies with recombinant bovine TMEM234 in disease models could help elucidate its potential role in these pathologies.

How might recombinant bovine TMEM234 be used to screen for therapeutic compounds?

Recombinant bovine TMEM234 could serve as a platform for therapeutic compound screening through several approaches:

  • Binding assays: Identify compounds that stabilize TMEM234 in its functional conformation or enhance its interaction with binding partners

  • Cell-based assays: Screen for compounds that restore proper localization or function of mutant TMEM234

  • Transport assays: If transport function is confirmed, screen for modulators of this activity

  • High-throughput stability screens: Identify compounds that enhance protein stability, potentially correcting folding defects in disease-associated variants

For meaningful screening, researchers should establish clear readouts that correlate with TMEM234 function, such as podocyte adhesion strength, filtration barrier integrity in cell models, or direct biochemical measures of protein activity.

What considerations are important when developing antibodies against bovine TMEM234 for research applications?

Developing antibodies against bovine TMEM234 for research applications requires special considerations due to its membrane topology:

  • Epitope selection: Target extracellular loops or termini for applications requiring recognition of native protein; intracellular domains for Western blotting or immunoprecipitation

  • Species cross-reactivity: Design antibodies recognizing conserved epitopes if cross-species applications are desired

  • Validation strategy: Include multiple controls (knockout/knockdown cells, peptide competition, multiple antibodies to different epitopes)

  • Application optimization: Different fixation and permeabilization protocols may be required for immunohistochemistry versus immunofluorescence

For recombinant bovine TMEM234, epitope-tagged versions can facilitate detection while antibodies against the native protein are being developed and validated. The study reporting TMEM234 immunofluorescence in human kidney sections demonstrates that effective antibodies can be generated, though it notes challenges with reliability in immune-electron microscopy applications.

How can CRISPR-Cas9 gene editing be optimized for studying bovine TMEM234?

Optimizing CRISPR-Cas9 gene editing for bovine TMEM234 studies requires:

  • Guide RNA design:

    • Target early exons to ensure complete loss of function

    • Avoid regions with high sequence similarity to other genes

    • Design multiple gRNAs targeting different sites

    • Validate efficiency using T7 endonuclease or sequencing assays

  • Delivery methods:

    • For primary bovine cells, nucleofection or lipofection may be most effective

    • Consider lentiviral delivery for difficult-to-transfect cells

    • Optimize Cas9:gRNA ratios for your specific cell type

  • Screening approaches:

    • Design PCR strategies for identifying edited clones

    • Consider reporter systems for enriching edited cells

    • Validate edits at protein level using Western blot

  • Phenotypic characterization:

    • Compare to phenotypes observed in zebrafish Tmem234 knockdown

    • Assess podocyte-specific functions if using kidney cell models

What proteomics approaches can identify binding partners of recombinant bovine TMEM234?

To identify binding partners of recombinant bovine TMEM234, several complementary proteomics approaches can be employed:

  • Affinity purification-mass spectrometry (AP-MS):

    • Express tagged recombinant bovine TMEM234 in relevant cell types

    • Optimize solubilization conditions to maintain protein-protein interactions

    • Use quantitative proteomics to compare TMEM234 pulldowns with controls

    • Include crosslinking options to capture transient interactions

  • Proximity labeling approaches:

    • Fuse TMEM234 to BioID or APEX2 enzymes

    • These enzymes biotinylate proteins in close proximity

    • Analyze biotinylated proteins by mass spectrometry

    • Particularly valuable for membrane proteins and their interaction networks

  • Crosslinking mass spectrometry (XL-MS):

    • Apply chemical crosslinkers to stabilize protein complexes

    • Identify crosslinked peptides by mass spectrometry

    • Provides information about interaction interfaces

  • Data analysis considerations:

    • Filter against appropriate controls (including tag-only)

    • Prioritize hits enriched in membrane or podocyte databases

    • Validate top candidates using orthogonal methods

How can live-cell imaging techniques be applied to study bovine TMEM234 dynamics?

Live-cell imaging techniques offer powerful insights into TMEM234 dynamics:

  • Fusion protein design:

    • Create recombinant bovine TMEM234 fused to fluorescent proteins (GFP, mCherry)

    • Place fluorescent tags on termini predicted to be cytoplasmic

    • Validate that fusion proteins maintain normal localization and function

  • Advanced microscopy approaches:

    • FRAP (Fluorescence Recovery After Photobleaching): Measure protein mobility within membranes

    • FRET (Förster Resonance Energy Transfer): Detect protein-protein interactions

    • Single-particle tracking: Follow individual TMEM234 molecules in the membrane

    • Super-resolution microscopy: Visualize nanoscale distribution patterns

  • Experimental applications:

    • Monitor protein trafficking through secretory pathway

    • Assess redistribution during podocyte injury or stress

    • Quantify turnover rates at the plasma membrane

    • Observe interactions with cytoskeletal elements or adhesion complexes

  • Analysis considerations:

    • Develop quantitative metrics for membrane distribution patterns

    • Use appropriate controls for photobleaching and phototoxicity

    • Consider the impact of overexpression on normal dynamics

How do functional studies of bovine TMEM234 complement zebrafish and mouse models?

Functional studies of recombinant bovine TMEM234 can complement existing zebrafish and mouse models in several ways:

  • Evolutionary conservation analysis:

    • Zebrafish studies have already demonstrated functional conservation between fish and mouse

    • Bovine studies can extend this comparison to ruminants

    • Identify species-specific adaptations versus core conserved functions

  • Mechanistic detail enhancement:

    • Biochemical studies with purified recombinant bovine protein can provide molecular mechanisms

    • Zebrafish models offer in vivo developmental context

    • Mouse models provide mammalian physiological relevance

  • Therapeutic translation opportunities:

    • Findings in multiple species strengthen translational potential

    • Bovine studies can identify conserved functional domains as therapeutic targets

    • Cross-species validation rules out species-specific artifacts

  • Experimental advantages:

    • Bovine tissues offer abundant source material for native protein studies

    • Recombinant bovine protein may have different expression/stability characteristics

    • Findings in bovine models may be particularly relevant to veterinary medicine

What strategies can resolve contradictory findings between bovine TMEM234 studies and other model systems?

When contradictory findings arise between studies using recombinant bovine TMEM234 and other model systems, researchers should:

  • Evaluate methodological differences:

    • Expression systems and tags used

    • Purification and experimental conditions

    • Cell types or developmental stages examined

    • Knockdown/knockout approaches employed

  • Consider species-specific biology:

    • Sequence differences at critical functional residues

    • Differential post-translational modifications

    • Species-specific binding partners or regulators

    • Evolutionary adaptations to different physiological demands

  • Perform direct comparative studies:

    • Side-by-side testing of orthologs from different species

    • Chimeric proteins to identify domains responsible for differences

    • Rescue experiments across species (as demonstrated with mouse Tmem234 rescuing zebrafish morphants)

  • Resolve through integrative approaches:

    • Combine structural, functional, and in vivo data

    • Consider evolutionary context of observed differences

    • Develop unifying models that account for apparent contradictions

How can ortholog comparison inform recombinant bovine TMEM234 experimental design?

Ortholog comparison can significantly enhance experimental design for recombinant bovine TMEM234 studies:

What are common challenges in expressing recombinant bovine TMEM234 and how can they be addressed?

Common challenges in expressing recombinant bovine TMEM234 and potential solutions include:

  • Low expression levels:

    • Optimize codon usage for expression host

    • Test different promoters and expression timing

    • Include chaperones or foldases as co-expression partners

    • Consider inducible expression systems with tight regulation

  • Protein misfolding or aggregation:

    • Lower expression temperature to slow folding

    • Include chemical chaperones in growth media

    • Test different cell lines with varied folding machinery

    • Explore fusion partners known to enhance solubility

  • Toxicity to host cells:

    • Use tightly controlled inducible systems

    • Reduce expression levels through promoter modulation

    • Consider specialized hosts designed for toxic proteins

    • Test expression in membrane-enriched systems

  • Poor membrane targeting:

    • Verify signal sequence functionality

    • Include trafficking enhancers in construct design

    • Consider species-matching the signal sequence to expression host

    • Evaluate subcellular localization using fluorescent tags

How can researchers optimize detergent selection for recombinant bovine TMEM234 purification?

Optimizing detergent selection for recombinant bovine TMEM234 purification requires systematic approach:

  • Initial screening strategy:

    • Test detergents spanning different physicochemical properties:

      • Maltosides (DDM, DM)

      • Glucosides (OG, NG)

      • Neopentyl glycols (LMNG)

      • Fos-cholines

      • Digitonin or GDN for milder extraction

    • Assess protein extraction efficiency by Western blot

    • Evaluate protein stability using thermal shift assays

    • Analyze monodispersity by size exclusion chromatography

  • Optimization considerations:

    • Detergent concentration (start at 2-3× CMC)

    • Extraction time and temperature

    • Buffer components (salt concentration, pH, additives)

    • Mixed detergent systems for optimal stability/extraction

  • Downstream application compatibility:

    • Functional assays may require specific detergents

    • Structural studies have different detergent requirements

    • Consider detergent exchange during purification

  • Alternative approaches:

    • Amphipols or nanodiscs for detergent-free final samples

    • Styrene maleic acid copolymer (SMA) for native lipid environment preservation

    • Lipid-detergent mixtures to stabilize native-like environment

What quality control methods ensure recombinant bovine TMEM234 is properly folded and functional?

Ensuring properly folded and functional recombinant bovine TMEM234 requires multiple quality control approaches:

  • Biophysical characterization:

    • Size exclusion chromatography: Monodisperse peak indicates homogeneous population

    • Circular dichroism: Confirms predicted secondary structure content

    • Thermal stability assays: Well-folded proteins show cooperative unfolding

    • Limited proteolysis: Properly folded proteins show defined digestion patterns

  • Functional verification:

    • Ligand binding assays if substrates are identified

    • Proteoliposome reconstitution and activity measurement

    • Cell-based complementation of TMEM234 knockout

    • Based on zebrafish studies, ability to rescue filtration barrier defects

  • Structural integrity assessment:

    • Antibody recognition of conformational epitopes

    • Mass spectrometry to confirm full-length protein and modifications

    • Hydrogen-deuterium exchange patterns consistent with predicted topology

    • Cysteine accessibility assays to confirm membrane topology

  • Comparative benchmarks:

    • Side-by-side comparison with native protein where possible

    • Relative stability in different conditions compared to related proteins

    • Consistent batch-to-batch properties as quality metric

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.