Recombinant Bovine Transmembrane protein 35 (TMEM35)

Shipped with Ice Packs
In Stock

Description

Chaperone Activity

TMEM35 (also termed NACHO) facilitates the assembly and functional expression of nicotinic acetylcholine receptors (nAChRs) in the ER . In bovine models, this activity may extend to other Cys-loop receptors (e.g., GABAA receptors), as observed in human and rodent studies .

Cancer Biology

  • Osteosarcoma: Bovine TMEM35 is upregulated in osteosarcoma (OSA) tissues (64.86% of cases) . Knockdown via siRNA inhibits:

    • Colony formation in soft agar (reduced by 40–60% in SaOS2/U2OS cells) .

    • Cell migration (50% reduction in wound-healing assays) .

    • Cell cycle progression (G1 phase arrest, S phase depletion) .

Neurological Functions

TMEM35 interacts with α7 nAChRs and modulates channel activity without affecting receptor trafficking . In bovine adrenal cells, TMEM35-derived protein TUF1 is upregulated during sodium depletion, suggesting roles in stress response .

Research Applications

Recombinant TMEM35 proteins are utilized in:

  • Mechanistic Studies: Investigating receptor assembly (e.g., α7 nAChR, GABAA) .

  • Therapeutic Target Validation: Screening for OSA treatments via siRNA or small-molecule inhibitors .

  • Antibody Development: Immunodetection in WB, ELISA .

Production and Handling

  • Storage: Lyophilized powders stable at -80°C; reconstitute in Tris/PBS buffers with glycerol .

  • Purity: Validated by SDS-PAGE (>90% for E. coli-expressed proteins) .

Challenges and Future Directions

Limited bovine-specific recombinant TMEM35 data necessitates further characterization. Priorities include:

  • Structural resolution (e.g., cryo-EM) to map bovine-specific domains.

  • Cross-species functional studies to validate conserved roles in receptor chaperoning and cancer.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
TMEM35A; NACHO; TMEM35; Novel acetylcholine receptor chaperone; Transmembrane protein 35A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM35A
Target Protein Sequence
MASPRTVTVVALSVALGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYVRALPLLKKMGIN SILLRKSIGALEVACGIVMTLVPGRPKDVANFFLLLLVLAVLFFHQLVGDPLKRYAHALV FGILLTCRLLIARKPEDRSSEKKSSPPGNAGSDGNAGNTEEQPSLYEKAPQGKMKLS
Uniprot No.

Target Background

Function
Transmembrane protein 35 (TMEM35) is a molecular chaperone involved in the proper assembly and functional expression of nicotinic acetylcholine receptors (nAChRs) throughout the brain. It plays a crucial role in the proper folding, assembly, function, and surface trafficking of alpha-7 (CHRNA7), alpha-4-beta-2, alpha-3-beta-2, and alpha-3-beta-4 receptors. TMEM35 stably associates with ribophorin-1 (RPN1) and ribophorin-2 (RPN2), components of the oligosaccharyl transferase (OST) complex, and with calnexin (CANX). Both RPN1/RPN2 and CANX are critical for NACHO-mediated effects on CHRNA7 assembly and function. TMEM35 facilitates the proper folding and assembly of alpha-6-beta-2 and alpha-6-beta-2-beta-3 receptors and acts at early stages of nAChRs subunit assembly. It also promotes the expression of the alpha-4(2):beta-2(3) stoichiometric form over the alpha-4(3):beta-2(2) form.
Database Links
Protein Families
DoxX family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein. Cytoplasmic vesicle. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the fundamental function of TMEM35 in cellular systems?

TMEM35 serves as an essential chaperone protein that regulates the functional expression of nicotinic acetylcholine receptors, particularly homomeric α7 nAChRs. Studies have shown that deletion of the tmem35a gene results in complete absence of α7 membrane expression and electrophysiological activity, while showing only residual cell surface expression of α3, α4, and α6-containing receptors . Beyond its role as a nAChR chaperone, TMEM35 appears to influence cell growth, migration, and cell cycle progression in certain cell types, particularly in cancer cell lines like osteosarcoma . The protein is also prominently expressed in HPA (hypothalamic-pituitary-adrenal) circuitry and limbic areas including the hippocampus and amygdala, suggesting important roles in neuroendocrine function and stress responses .

How does TMEM35 expression vary across different cell types?

TMEM35 shows significant cell type-dependent expression patterns, which directly correlates with cells' ability to express surface α7 nAChRs. Western blot analyses have demonstrated a rank order for TMEM35 protein expression of GH3 ≥ GH4C1 >> SH-SY5Y, with no detectable expression in other cell lines including SH-EP1, HEK293, RAW264.7, and H9C2 . This expression pattern generally corresponds with the ability of these cells to express surface α7 nAChRs when transfected with appropriate DNA constructs. Interestingly, some cell types like mouse macrophages express surface α7 nAChRs without detectable TMEM35, suggesting alternative chaperone mechanisms may exist in certain cell lineages .

What structural features are essential for TMEM35 function?

The C-terminal region of TMEM35 is critically important for its chaperone function. Experimental data shows that either removing amino acids from the C-terminus or adding various protein tags dramatically decreases its chaperone activity . The human TMEM35 protein comprises 167 amino acids with a molecular weight of approximately 18,440 Da and an isoelectric point of 10.09 . The protein contains four transmembrane domains, with the C-terminal motif (VKVS) potentially playing a role in endoplasmic reticulum retention, suggesting that TMEM35 may have some functional effects outside the ER as well .

What molecular mechanisms underlie TMEM35's chaperone activity for nicotinic receptors?

The precise molecular mechanisms through which TMEM35 facilitates nAChR assembly and trafficking remain incompletely understood. Knockout studies demonstrate that TMEM35 is necessary and sufficient for the assembly and trafficking of homomeric α7 receptors, while it plays a facilitating role for heteromeric receptors containing α3, α4, and α6 subunits . The C-terminal domain appears essential for this function, as deletion of as few as the last four amino acids significantly reduces chaperone activity .

TMEM35 likely operates primarily within the endoplasmic reticulum, assisting with proper folding, subunit assembly, and quality control of nAChRs before their transport to the cell surface. Protein interaction studies using the STRING database predict that TMEM35 may interact with several neuronal signaling molecules, including neuropeptide Y (NPY), nerve growth factor (NGF), NGF receptor (NGFR), brain-derived neurotropic factor (BDNF), vasoactive intestinal peptide (VIP), and calcitonin-related polypeptide β (CALCB) . These predicted interactions suggest TMEM35 may participate in broader signaling networks beyond its chaperone function.

How does TMEM35 knockout affect neurological function in animal models?

TMEM35 knockout mice exhibit multiple neurological and behavioral phenotypes related to stress responses, memory function, and pain perception. These models show elevated basal corticosterone levels accompanied by increased anxiety-like behavior, despite maintaining the ability to mount normal corticosterone responses to restraint stress . This suggests TMEM35 plays a role in basal HPA axis regulation but is not essential for stress-induced HPA axis activation.

Additionally, TMEM35 knockout mice exhibit thermal hyperalgesia and mechanical allodynia, indicating a role in pain processing pathways . Transcriptomic analysis of the spinal cord in these mice revealed 72 differentially expressed genes compared to wild-type controls, with pathway analysis suggesting increased neuroinflammation as a potential contributor to the pain phenotype .

What role does TMEM35 play in cancer cell biology?

TMEM35 appears to significantly impact cancer cell growth, migration, and cell cycle progression. In osteosarcoma (OSA), TMEM35 expression is upregulated compared to normal tissues . RNA interference studies targeting TMEM35 in OSA cell lines (SaOS2 and U2OS) revealed that TMEM35 knockdown inhibits colony formation ability in soft agar, suggesting reduced anchorage-independent growth potential .

Flow cytometric analysis demonstrated that TMEM35 knockdown results in G1 phase arrest and a decreased cell population at the S phase, indicating TMEM35 influences cell cycle progression . Additionally, wound-healing assays and Boyden chamber assays showed that TMEM35 knockdown inhibits cell migration in OSA cells, a finding particularly relevant given that metastasis is a primary deleterious characteristic of osteosarcoma .

These findings collectively suggest that TMEM35 may represent a potential therapeutic target in cancers where it is overexpressed, though more research is needed to determine the precise signaling pathways through which TMEM35 influences cancer cell biology.

What are the predicted functional protein interactions of TMEM35?

Protein interaction database analysis using STRING has identified several potential functional partners for TMEM35. These include neuropeptide Y (NPY), nerve growth factor (NGF), NGF receptor (NGFR), brain-derived neurotropic factor (BDNF), vasoactive intestinal peptide (VIP), and calcitonin-related polypeptide β (CALCB) . This network of predicted interactions suggests TMEM35 may participate in signaling pathways related to neuronal differentiation, survival, and function.

What are optimal methods for expressing recombinant bovine TMEM35 in research settings?

The expression of functional recombinant bovine TMEM35 requires careful consideration of expression systems and protein engineering:

  • Expression System Selection: For functional studies, mammalian expression systems like GH4C1 or GH3 cells are recommended as they naturally express TMEM35 and likely possess the cellular machinery for proper folding and processing . For higher yields, HEK293 cells can be used, though co-expression with RIC3 may be necessary to achieve full functionality .

  • Vector Design: When designing expression constructs, the C-terminal integrity of TMEM35 is crucial. Research has shown that adding C-terminal tags like GFP or myc-DDK significantly reduces TMEM35 chaperone activity by approximately 75% . If tags are necessary, N-terminal tags are preferable, though their impact on function should be validated.

  • Transfection Protocol: For transient expression, lipid-based transfection methods such as Lipofectamine 2000 are effective. The typical protocol involves:

    • Combining siRNAs or expression plasmids with Lipofectamine 2000 in serum-free medium

    • Incubating at room temperature to form complexes

    • Adding the mixture dropwise to cells

    • Incubating for 4-6 hours before replacing with complete medium

    • Culturing for 3 days before assessing expression or function

  • Purification Considerations: As a transmembrane protein, TMEM35 requires detergent solubilization for purification. Mild detergents are recommended to maintain structure and function.

  • Functional Validation: The activity of recombinant TMEM35 can be verified through co-expression with α7 nAChR in non-permissive cell lines followed by surface receptor quantification using radiolabeled α-bungarotoxin binding assays .

What RNA interference approaches are effective for studying TMEM35 function?

RNA interference has proven effective for investigating TMEM35 function in various cell models:

  • siRNA Design: Effective siRNA sequences targeting TMEM35 include TMEM35-si-1: CCAGAACCGUAACUAUUGU and TMEM35-si-2: CAACCCUCCUUAUAUGAGA . These sequences have been validated in osteosarcoma cell lines and show significant knockdown efficiency.

  • Transfection Protocol: Combine siRNAs with Lipofectamine 2000 in serum-free DMEM at room temperature, add the mixture dropwise to cells, and incubate for 4-6 hours. Replace with fresh medium containing 10% fetal bovine serum and appropriate antibiotics, then culture for 3 days before assessing knockdown efficiency and functional effects .

  • Knockdown Validation: Confirm siRNA effectiveness using reverse transcription-quantitative polymerase chain reaction (RT-qPCR) to measure TMEM35 mRNA levels and Western blotting to assess protein reduction .

  • Functional Assays: Following TMEM35 knockdown, several functional assays can be employed:

    • Cell proliferation assays to assess growth effects

    • Colony formation in soft agar to evaluate anchorage-independent growth

    • Flow cytometric analysis to determine cell cycle distribution

    • Wound-healing and Boyden chamber assays to measure cell migration

    • α-bungarotoxin binding assays to quantify surface α7 nAChR expression

What methodologies can measure the chaperone activity of recombinant TMEM35?

To quantify TMEM35's chaperone function for nAChRs, the following methodologies are recommended:

  • Surface Receptor Binding Assays: The gold standard for measuring TMEM35 chaperone activity involves quantifying surface α7 nAChR expression through radioligand binding:

    • Transfect non-permissive cells (e.g., HEK293, H9C2) with α7 nAChR and TMEM35

    • Incubate intact cells (typically 200,000 cells/well) with 10 nM 125I-α-bungarotoxin for 3 hours at 4°C

    • Wash cells three times and count radioactivity using a gamma counter

    • Compare binding in TMEM35-expressing cells versus controls

  • Comparative Functional Assessment: When evaluating different TMEM35 variants or species homologs, establish a reference standard:

TMEM35 VariantRelative Chaperone ActivityNotes
Native TMEM35100% (reference)Highest activity
TMEM35-GFP~25%C-terminal GFP tag reduces function
TMEM35-myc-DDK<25%Multiple C-terminal tags severely impair function
TMEM35-ΔC4 (last 4 aa deleted)~50%Partial function retained
  • Electrophysiological Measurements: For functional validation of surface receptors:

    • Co-express TMEM35 and α7 nAChR in Xenopus oocytes or mammalian cells

    • Perform patch-clamp recordings to measure acetylcholine-evoked currents

    • Analyze current amplitude, kinetics, and pharmacological properties

  • Imaging Approaches: Fluorescence-based methods can complement binding assays:

    • Create pH-sensitive fluorescent protein-tagged α7 nAChR constructs

    • Monitor surface expression through live-cell imaging

    • Quantify fluorescence intensity as a measure of trafficking efficiency

How should researchers interpret cell-type dependence of TMEM35 expression?

The cell-type dependent expression of TMEM35 presents both challenges and opportunities for research interpretation:

  • Expression Pattern Analysis: When analyzing TMEM35 expression data across different cell types, consider the established hierarchy: GH3 ≥ GH4C1 >> SH-SY5Y with no detectable expression in other cell lines (SH-EP1, HEK293, RAW264.7, H9C2) . This pattern correlates with the cells' ability to express surface α7 nAChRs when transfected with appropriate DNA.

  • Experimental Design Implications: For studies requiring functional expression of α7 nAChRs, select cell models based on known TMEM35 expression patterns. For cells lacking endogenous TMEM35 (like HEK293), co-expression of TMEM35 along with target receptors is necessary for functional studies .

  • Interpreting Negative Results: When surface α7 nAChR expression fails in a particular cell line, consider TMEM35 absence as a potential explanation rather than issues with the receptor construct itself.

  • Tissue-Specific Considerations: TMEM35 expression appears primarily neuron-specific in vivo , but interesting exceptions exist. For example, mouse macrophages express surface α7 nAChRs without detectable TMEM35, suggesting alternative chaperone mechanisms in certain cell lineages .

  • Developmental and Regulatory Context: Consider that TMEM35 expression may vary not only by cell type but also by developmental stage or in response to cellular stressors, potentially explaining some context-dependent research findings.

  • Statistical Approach: When comparing TMEM35 expression across cell types, use appropriate normalization controls and statistical tests suitable for potentially non-normal distributions often seen with cell-type specific genes.

What controls are essential when validating recombinant bovine TMEM35 function?

Rigorous validation of recombinant bovine TMEM35 requires several critical controls:

  • Positive Expression Controls: Include cell lines with known TMEM35 expression (GH3, GH4C1) as positive controls for antibody validation and protein detection methods .

  • Negative Expression Controls: Use cell lines that lack detectable TMEM35 (HEK293, SH-EP1) as negative controls to establish detection thresholds and identify potential cross-reactivity .

  • Activity Baseline Controls: When assessing chaperone function through surface α7 nAChR expression:

    • Negative control: Cells transfected with α7 nAChR alone should show minimal surface expression

    • Positive control: Cells co-transfected with α7 nAChR and established functional TMEM35 (human or rat) provide reference activity levels

    • System validation: RIC3 co-expression can serve as an alternative positive control for α7 surface expression

  • Tag Effect Controls: If tagged versions of TMEM35 are used, include both tagged and untagged versions to quantify any functional impact of the tag:

    • C-terminal tags typically reduce function by 75% or more

    • N-terminal tags may have less impact but should still be validated

    • Tag removal through precision proteases can confirm tag effects

  • Species Comparison Controls: Include human or rodent TMEM35 alongside bovine TMEM35 to establish relative functional equivalence or identify species-specific differences.

  • Domain Functionality Controls: Consider testing constructs with specific mutations or deletions (particularly C-terminal modifications) to validate structure-function relationships observed in other species.

  • Concentration-Response Relationships: Establish dose-dependent effects by varying the amount of TMEM35 expression plasmid while keeping α7 nAChR plasmid constant.

How can researchers analyze TMEM35 involvement in complex phenotypes?

Determining TMEM35's role in complex phenotypes such as pain, memory, or stress responses requires sophisticated analytical approaches:

  • Causal Relationship Analysis: To establish whether TMEM35 directly causes observed phenotypes:

    • Conduct gene dose-response studies (heterozygous vs. homozygous knockouts)

    • Perform temporal manipulations (inducible knockdown/knockout)

    • Implement rescue experiments with wild-type and mutant constructs

  • Pathway Dissection: For complex phenotypes like the pain response seen in TMEM35 knockout mice:

    • Analyze transcriptome changes in relevant tissues (e.g., 72 differentially expressed genes in spinal cord)

    • Apply pathway analysis tools (like Ingenuity Pathway Analysis) to identify affected networks

    • Use pharmacological agents to target specific pathway components

  • Cell-Type Specific Analysis: As TMEM35 is neuron-specific, use conditional knockout approaches to distinguish:

    • Primary effects in neurons expressing TMEM35

    • Secondary effects in non-neuronal cells or neuronal populations lacking TMEM35

    • System-level consequences of altered neuronal function

  • Behavioral Dissection: For complex behavioral phenotypes:

    • Separate different components (e.g., for memory: acquisition vs. consolidation vs. retrieval)

    • Use multiple behavioral paradigms assessing the same construct

    • Control for confounding factors (e.g., anxiety affecting memory performance)

  • Electrophysiological Correlates: Connect molecular changes to functional outcomes:

    • Analyze changes in long-term potentiation in relevant circuits

    • Correlate receptor expression with synaptic function

    • Link electrophysiological deficits to behavioral outcomes

  • Proteomic Analysis: In TMEM35 knockout models, synaptosomal proteomics has revealed lower levels of postsynaptic molecules important for synaptic plasticity, including PSD95 and N-methyl-d-aspartate receptors . This approach can identify molecular mechanisms underlying complex phenotypes.

What are common challenges in recombinant bovine TMEM35 research and their solutions?

Researchers working with recombinant bovine TMEM35 may encounter several technical challenges:

  • Protein Detection Difficulties:

    • Challenge: Limited commercial antibodies with variable specificity for bovine TMEM35.

    • Solution: Validate antibodies using positive controls (GH3/GH4C1 cells) and negative controls (HEK293); consider generating custom antibodies against conserved epitopes; use epitope-tagged constructs for detection when appropriate .

  • Low Expression Levels:

    • Challenge: TMEM35 is a small transmembrane protein that may express poorly in heterologous systems.

    • Solution: Optimize codon usage for expression system; use strong promoters; consider cell lines with established TMEM35 expression (GH3, GH4C1) for comparative studies .

  • C-Terminal Modification Effects:

    • Challenge: C-terminal modifications dramatically decrease TMEM35 activity.

    • Solution: Use N-terminal tags if necessary; remove tags post-purification using precision proteases; validate function through α7 nAChR expression assays; consider leaving the C-terminus unmodified .

  • Functional Validation Complexities:

    • Challenge: Distinguishing between non-functional protein and inadequate expression.

    • Solution: Include positive controls (human or rat TMEM35) with established activity; use multiple detection methods (Western blot, immunofluorescence); quantify both protein levels and functional outcomes.

  • Species-Specific Differences:

    • Challenge: Potential functional differences between bovine and other mammalian TMEM35 proteins.

    • Solution: Perform comparative functional studies with human and rodent TMEM35; identify any species-specific sequence variations, particularly in functional domains.

How can researchers optimize experimental design for TMEM35 functional studies?

To maximize the validity and reproducibility of TMEM35 functional studies:

  • Cell Line Selection:

    • For receptor expression studies: Use cells with minimal endogenous TMEM35 (HEK293, SH-EP1, H9C2) to avoid confounding effects

    • For knockdown studies: Choose cells with robust endogenous expression (GH3, GH4C1)

    • For comparative studies: Include both permissive and non-permissive cell lines to demonstrate TMEM35 dependence

  • Construct Design Optimization:

    • Maintain C-terminal integrity for maximal function

    • If tags are necessary, position them at the N-terminus

    • Consider using cleavable tags for purification followed by tag removal

    • Include wild-type TMEM35 as reference standard

  • Transfection Protocol Refinement:

    • Establish optimal DNA ratios for co-transfection experiments (particularly important for TMEM35:nAChR ratios)

    • Determine ideal cell density and transfection timing

    • Consider stable expression for long-term studies

    • Allow sufficient time (3-6 days) for receptor assembly and trafficking

  • Functional Readout Selection:

    • Primary measure: 125I-α-bungarotoxin binding for quantifying surface α7 nAChRs

    • Secondary validation: Electrophysiological recording of receptor function

    • Tertiary confirmation: Downstream signaling or calcium imaging

  • Control Implementation:

    • Include parallel experiments with established TMEM35 variants

    • Test multiple independent clones or transfections

    • Use both positive controls (known functional variants) and negative controls (empty vector, inactive mutants)

What statistical approaches are appropriate for analyzing TMEM35 expression and function data?

Proper statistical analysis of TMEM35 data requires consideration of experimental design and data characteristics:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.