Recombinant Bovine Transmembrane protein 41A (TMEM41A)

Shipped with Ice Packs
In Stock

Description

Research Applications

Recombinant Bovine TMEM41A is utilized in:

Mechanistic Studies

  • Investigating lipid mobilization and autophagy in bovine cell models .

  • Analyzing interactions with viral proteins to understand host-pathogen dynamics .

Diagnostic and Therapeutic Development

  • Serving as an antigen for antibody production in veterinary diagnostics .

  • Exploring its potential as a biomarker for diseases linked to lipid dysregulation .

Comparative Analysis Across Species

TMEM41A orthologs exhibit functional conservation but differ in expression systems and applications:

SpeciesExpression HostTagKey ApplicationsReference
BovineCustomizableHis-tagLipid metabolism, autophagy studies
HumanMammalian cellsHis-tagCancer research (e.g., endometrial carcinoma)
MouseE. coliHis/Myc-DDKViral replication, autophagy mechanisms

Quality Control

  • Endotoxin Levels: <1.0 EU/μg .

  • Batch Consistency: Verified via SDS-PAGE and mass spectrometry .

Role in Lipid Homeostasis

Knockdown studies in other species reveal that TMEM41A/B deficiency disrupts lipid droplet dynamics, leading to impaired viral entry (e.g., pseudorabies virus) and autophagy . These findings suggest bovine TMEM41A may similarly regulate lipid pathways critical for cellular health .

Association with Disease

In humans, TMEM41A overexpression correlates with poor prognosis in endometrial carcinoma, immune dysregulation, and altered RNA modifications . While direct bovine studies are lacking, its structural similarity positions it as a candidate for veterinary oncology research.

Viral Pathogenesis

TMEM41B (a homolog) is essential for flavivirus and coronavirus replication by modulating ER membrane curvature . This highlights TMEM41A’s potential role in zoonotic viral studies .

Future Directions

  • Functional Genomics: CRISPR-based studies to elucidate bovine-specific roles in lipid metabolism.

  • Therapeutic Targeting: Exploring TMEM41A inhibitors for antiviral or anticancer applications.

  • Biomarker Development: Validating its diagnostic potential in bovine metabolic disorders.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing it according to your specifications.
Synonyms
TMEM41A; Transmembrane protein 41A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
18-264
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
TMEM41A
Target Protein Sequence
LYLLSTRLPRASTLVSAEESGDRSLWFPSDLAELRELSEVLREYRKEHQVYVFLLFCSAY LYKQSFAIPGSSFLNVLAGALFGPWLGLLLCCVLTSVGATGCYLLSSVFGKQLVVFYFPD KVALLQKKVEENRNGLFFFLLFLRLFPMTPNWFLNLSAPILNIPIVQFFFSVLIGLIPYN FICVQTGSILSTLTSLDALFSWETAFKLLAIALVALVPGTLIKKFSQKDLRLKETSNTHS LNSRKVT
Uniprot No.

Target Background

Database Links
Protein Families
TMEM41 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is TMEM41A and what structural features characterize it?

TMEM41A (Transmembrane protein 41A) is a multipass transmembrane protein that belongs to the VTT domain family, which includes VMP1, TMEM41A/B, and TMEM64 . The protein contains multiple transmembrane segments with a predicted tandem repeat structure exhibiting 2-fold rotational symmetry . Structural bioinformatics analyses suggest TMEM41A contains re-entrant loops (protein segments that enter but exit on the same side of the membrane bilayer) and a pseudo-inverted repeat topology . The bovine TMEM41A sequence consists of hydrophobic transmembrane domains interspersed with hydrophilic regions, with the functional expression region spanning amino acids 18-264 . These structural features strongly suggest that TMEM41A may function as a transporter for currently uncharacterized substrates .

  • How does TMEM41A expression vary across different tissues and cell types?

TMEM41A expression has been confirmed in multiple tissues through various detection methods. Immunohistochemical analysis has demonstrated TMEM41A expression in human pancreatic and rectal tissues . At the cellular level, TMEM41A has been localized in HepG2 hepatocellular carcinoma cells using immunofluorescence techniques . Western blot analysis has also confirmed TMEM41A expression in mouse liver tissue . In pathological contexts, TMEM41A exhibits significant overexpression in endometrial carcinoma compared to normal tissue, correlating with clinical parameters including stage, age, histological subtype, and tumor grade . This differential expression pattern suggests potential tissue-specific functions that may become dysregulated in disease states.

  • What are the known or predicted subcellular localizations of TMEM41A?

Based on structural homology with TMEM41B, which has been definitively localized to the endoplasmic reticulum (ER), TMEM41A is predicted to primarily reside in the ER membrane . Immunocytochemistry/immunofluorescence studies have visualized TMEM41A in HepG2 cells with a distribution pattern consistent with membrane protein localization . The protein's multiple transmembrane domains support its insertion into cellular membranes . Given the structural predictions indicating TMEM41A may function as a transporter or channel, its precise localization within the ER or other membrane compartments is critical for understanding its functional role in cellular processes .

  • How does TMEM41A differ from other members of the VTT domain family?

While sharing the VTT domain with family members VMP1, TMEM41B, and TMEM64 , TMEM41A likely serves distinct functions. TMEM41B has been extensively characterized as an ER Ca2+ release channel that plays crucial roles in autophagy, lipid metabolism, and viral infection processes . TMEM41B deficiency causes ER Ca2+ overload with downstream consequences for T cell signaling and metabolism . Though TMEM41A and TMEM41B share structural similarities suggesting both may function as transporters or channels , their differential expression patterns and distinct associations with disease outcomes indicate potentially complementary roles in cellular processes. TMEM41A's specific overexpression in endometrial carcinoma suggests unique functions in disease progression that may not be shared by other family members .

Advanced Research Questions

  • What evidence supports TMEM41A's potential function as a membrane transporter or channel?

Compelling structural evidence suggests TMEM41A functions as a membrane transporter or channel. Ab initio modeling and evolutionary covariance analyses reveal a tandem repeat structure with 2-fold rotational symmetry, re-entrant loops, and a pseudo-inverted repeat topology—structural features characteristic of secondary active transporters . These structural elements closely resemble those found in Cl-/H+ antiporters, suggesting TMEM41A may function as an ion transporter, possibly using H+ antiporter activity . The related protein TMEM41B has been definitively characterized as an ER Ca2+ release channel through electrophysiological studies demonstrating that purified recombinant TMEM41B forms a concentration-dependent Ca2+ channel . Given their structural similarities, TMEM41A likely possesses similar channel or transporter functions, though potentially with different substrate specificity or regulatory mechanisms.

  • How does TMEM41A expression correlate with cancer progression and immune function?

TMEM41A overexpression shows significant correlations with cancer progression and immune alterations. In endometrial carcinoma, TMEM41A is consistently overexpressed compared to normal tissues and serves as an independent factor for poor prognosis . This overexpression correlates with advanced clinical stage, age, tumor grade, and survival status . Notably, TMEM41A overexpression significantly correlates with alterations in the immune microenvironment, affecting stromal score, immune score, and multiple immune cell populations including:

Immune Cell PopulationCorrelation with TMEM41A Overexpression
NK CD56 bright cellsSignificant correlation
Dendritic cells (immature and activated)Significant correlation
T cells (regulatory, helper, cytotoxic)Significant correlation
Mast cellsSignificant correlation
EosinophilsSignificant correlation
NeutrophilsSignificant correlation
MacrophagesSignificant correlation

These findings suggest TMEM41A may influence immune cell recruitment, differentiation, or function within the tumor microenvironment, potentially explaining its association with poor prognosis .

  • What structural models best explain TMEM41A's molecular function?

Advanced bioinformatics approaches have yielded valuable insights into TMEM41A's structure that inform its potential molecular functions. Evolutionary covariance analysis reveals a tandem repeat structure that becomes evident through covariance data despite being difficult to detect by sequence analysis alone . DMPfold modeling successfully produced a structural model for the core region (after removing 100 N-terminal residues predicted to be intrinsically disordered) that aligns with the predicted topology . The model shows:

  • Two halves of the protein can be aligned with a TMscore of 0.5, indicating they share the same fold

  • The duplicate fold is inserted into the membrane with opposing topology, resulting in 2-fold rotational symmetry about the membrane plane

  • Clustering of conserved residues within the structure, supporting functional importance

This structural arrangement strongly resembles that of secondary active transporters, particularly Cl-/H+ antiporters . The presence of re-entrant loops further supports a transporter function, as these structural elements often form parts of the substrate translocation pathway in membrane transporters .

  • How can researchers effectively differentiate between TMEM41A and TMEM41B functions in experimental systems?

Differentiating between TMEM41A and TMEM41B functions requires multi-faceted experimental approaches:

ApproachMethodologyExpected Outcome
Selective knockdown/knockoutsiRNA, CRISPR targeting specific family membersDetermine unique phenotypes
Rescue experimentsExpressing one protein in cells lacking the otherTest functional complementation
Domain swappingCreating chimeric proteins with domains from eachIdentify critical functional regions
Tissue-specific expressionqRT-PCR, IHC across tissue panelsMap differential expression patterns
Selective antibodiesEpitopes unique to each proteinDistinguish protein localization
Substrate specificityTransport assays with different potential substratesDetermine unique transport profiles

While both proteins likely function as transporters or channels based on structural predictions , TMEM41B has been specifically characterized as an ER Ca2+ release channel . Comparing the effects of TMEM41A vs. TMEM41B manipulation on ER Ca2+ levels would directly test functional overlap. Additionally, examining differential effects on processes like autophagy, viral infection, and immune cell function would help delineate their unique cellular roles .

Methodological Approaches

  • What techniques are most effective for detecting and quantifying TMEM41A expression in experimental systems?

Multiple complementary techniques can effectively detect and quantify TMEM41A expression:

TechniqueApplicationsAdvantagesLimitations
Western BlotProtein expression in tissue/cell lysatesSemi-quantitative, detects specific proteinRequires validated antibodies
Immunohistochemistry (IHC)Tissue localizationPreserves tissue architectureVariable sensitivity
Immunocytochemistry (ICC)Cellular localizationHigh-resolution subcellular localizationLimited quantification
qRT-PCRmRNA expressionHighly sensitive and quantitativeMeasures transcript not protein
RNA-SeqTranscriptome-wide expressionUnbiased, discovers variantsComplex data analysis

Research has successfully employed Western blot to detect TMEM41A in mouse liver tissue lysates using specific antibodies at a 1/500 dilution . Immunohistochemistry at 1/100 antibody dilution effectively visualizes TMEM41A in human pancreas and rectum tissues . For cellular localization, immunofluorescence with anti-TMEM41A antibodies at 1/100 dilution followed by fluorophore-conjugated secondary antibodies provides clear visualization in cell lines such as HepG2 . For quantitative expression analysis across different conditions or disease states, qRT-PCR and RNA-Seq approaches offer higher sensitivity and throughput .

  • How can researchers optimize expression and purification of recombinant TMEM41A for functional studies?

Optimizing expression and purification of recombinant TMEM41A requires specialized approaches for membrane proteins:

StageMethodologyKey Considerations
Expression System SelectionBacterial (E. coli), insect cells, mammalian cellsBalance between yield and proper folding
Vector DesignAffinity tags, fusion partnersTag position to minimize functional interference
Expression RegionAmino acids 18-264 for bovine TMEM41AFocus on structured regions, exclude disordered segments
SolubilizationDetergent selection (DDM, CHAPS, etc.)Maintaining native structure
PurificationIMAC, size exclusion chromatographyPurity and functional integrity
StorageTris-based buffer with 50% glycerolPrevent freeze-thaw damage

For recombinant bovine TMEM41A, expressing the region spanning amino acids 18-264 has been successful . The purified protein can be stored in a Tris-based buffer with 50% glycerol optimized for stability . For functional studies, particularly when investigating potential channel or transporter activity, reconstitution into proteoliposomes followed by electrophysiology would be appropriate, similar to approaches used for TMEM41B . Avoiding repeated freeze-thaw cycles by storing working aliquots at 4°C for up to one week helps maintain protein functionality .

  • What experimental approaches can determine if TMEM41A functions as an ion channel or transporter?

Several complementary experimental approaches can determine TMEM41A's potential function as an ion channel or transporter:

ApproachMethodologyInformation Gained
ElectrophysiologyPatch-clamp of proteoliposomes with purified proteinChannel conductance, ion selectivity, gating
Flux AssaysFluorescent indicators (Ca2+, pH, etc.) in vesiclesTransport rates, substrate specificity
Structure-FunctionMutagenesis of predicted functional residuesCritical residues for channel/transport
Cellular PhenotypesTMEM41A knockout/overexpressionPhysiological consequences of altered function
Comparative AnalysisFunctional comparison with TMEM41BShared vs. unique properties

Based on the characterization of TMEM41B as a Ca2+ channel and structural predictions suggesting TMEM41A may function as an H+ antiporter , initial studies should focus on these ions as potential substrates. Single-channel electrophysiology with purified recombinant TMEM41A reconstituted into lipid bilayers would directly test for channel activity. For transporter function, liposomes containing purified TMEM41A could be loaded with fluorescent indicators sensitive to different ions to monitor transport. Mutagenesis of conserved residues identified through evolutionary analysis would help pinpoint the molecular determinants of function.

  • How can researchers effectively investigate TMEM41A's role in disease progression?

Investigating TMEM41A's role in disease progression requires multi-faceted approaches:

ApproachMethodologyInsights Gained
Expression AnalysisRNA-Seq, IHC tissue microarraysCorrelation with disease stages
Survival AnalysisKaplan-Meier, multivariate Cox regressionPrognostic significance
Genetic ManipulationCRISPR knockout/knockin in disease modelsCausal role in pathophysiology
Pathway AnalysisTranscriptomics after TMEM41A modulationDownstream effectors
Immune CorrelationFlow cytometry, cytokine profilingMechanistic link to immune alterations
Therapeutic TargetingSmall molecule screening, antibody developmentPotential intervention strategies

For TMEM41A, researchers have successfully employed Cox regression analysis to identify it as an independent prognostic factor in endometrial carcinoma . Nomogram models have demonstrated the correlation between TMEM41A expression levels and patient survival time at 1, 3, and 5 years . Similar approaches in other cancer types or diseases would expand understanding of TMEM41A's clinical relevance. Experimental models with TMEM41A knockdown or overexpression could investigate effects on processes like calcium homeostasis, immune cell function, or tumor growth rates to establish causal relationships with disease progression.

  • What approaches can identify TMEM41A-interacting proteins and regulatory networks?

Multiple complementary approaches can identify TMEM41A-interacting proteins and regulatory networks:

ApproachMethodologyStrengths
Proximity LabelingBioID, APEX2, TurboIDIdentifies nearby proteins in living cells
Co-immunoprecipitationPull-down with anti-TMEM41A antibodiesCaptures physiological protein complexes
Yeast Two-HybridMembrane-specific Y2H variantsFocused on direct protein-protein interactions
Cross-linking Mass SpectrometryCovalent capture of interactionsPreserves transient interactions
Computational PredictionCo-expression analysis, evolutionary couplingGenome-wide scope

For membrane proteins like TMEM41A, proximity labeling approaches are particularly valuable as they can identify proteins in spatial proximity without requiring stable interactions. Given TMEM41A's likely localization to the ER membrane, BioID or APEX2 fusions targeted to this compartment would help identify the local protein environment. Comparative interactome mapping between TMEM41A and the better-characterized TMEM41B could reveal shared and distinct interactors, providing insights into their potentially overlapping functions. Given TMEM41A's correlation with immune cell populations in cancer contexts , interactome analysis in immune cells compared to other cell types might reveal context-specific regulatory networks.

  • How can researchers design effective TMEM41A knockout and overexpression models?

Designing effective TMEM41A manipulation models requires careful consideration of several factors:

Model TypeDesign ConsiderationsValidation Methods
CRISPR KnockoutTarget conserved exons, avoid off-targetsWestern blot, genomic sequencing
Conditional KnockoutTissue-specific or inducible systemsVerify tissue-specific deletion
siRNA/shRNATest multiple sequences, control for off-targetsqRT-PCR, Western blot
OverexpressionPhysiological vs. constitutive promotersWestern blot, immunofluorescence
Tagged ConstructsTag position to minimize functional interferenceVerify proper localization
Rescue ConstructsSilent mutations resistant to CRISPR/RNAiFunctional restoration assays

For TMEM41A, knockout models should target central exons within the core functional region (amino acids 18-264) rather than N-terminal regions predicted to be disordered . CRISPR guide RNAs should be carefully designed to avoid off-target effects on the related TMEM41B gene. For overexpression studies, constructs should include the full coding sequence with careful consideration of tag placement to avoid disrupting transmembrane domains. Functional validation should examine effects on processes linked to TMEM41A function, such as ER Ca2+ levels (by comparison with TMEM41B) , and disease-relevant phenotypes such as immune cell function given TMEM41A's correlation with immune alterations in cancer .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.