Recombinant Bovine Transmembrane protein 50B (TMEM50B)

Shipped with Ice Packs
In Stock

Description

Functional Roles

TMEM50B is implicated in:

  • Intracellular Trafficking: Facilitates late endosome-to-vacuole transport via multivesicular body sorting .

  • Membrane Protein Regulation: Modulates leptin receptor (LEPR) surface expression, influencing metabolic signaling .

  • Neurological Development: Mouse studies show high expression in glial cells (e.g., Bergmann glia) during cerebellar development, suggesting roles in neurogenesis .

Key Pathways:

  • ER-Golgi membrane dynamics .

  • Growth hormone receptor modulation (indirectly via LEPROTL1 interaction) .

Research Applications

Recombinant bovine TMEM50B is primarily used in:

  • Biochemical Assays: ELISA, Western blot, and protein interaction studies .

  • Structural Studies: Investigating transmembrane topology and ER/Golgi localization .

  • Disease Modeling: Exploring links to metabolic disorders (e.g., leptin resistance) and neurodevelopmental conditions .

ApplicationExperimental Findings
Protein LocalizationConfirmed ER/Golgi localization via immunofluorescence in rat glial cells .
Interaction StudiesBinds LEPROTL1 (leptin receptor-related protein) with high affinity .
Developmental BiologymRNA expression peaks in postnatal mouse cerebellum and olfactory bulb .

Gene and Protein Information

Gene Details:

  • Gene Name: TMEM50B

  • Synonyms: C21orf4, HCVP7TP3 .

  • UniProt ID: Q3SZL9 (Bovine) .

Evolutionary Conservation:

  • 95% sequence homology with human TMEM50B (UniProt: P56557) .

  • Paralogs include TMEM50A, which shares functional overlap in membrane trafficking .

Production and Quality Control

Expression Systems:

  • Bacterial: High yield (>1 mg/mL) in E. coli but may lack mammalian post-translational modifications .

  • Mammalian: Used for native folding studies, though lower yield .

Quality Metrics:

  • Purity: Validated by SDS-PAGE and mass spectrometry .

  • Stability: Maintains activity for ≥6 months at -80°C; avoid repeated freeze-thaw cycles .

Challenges and Future Directions

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
TMEM50B; Transmembrane protein 50B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM50B
Target Protein Sequence
MAGFLDNFRWPECECIDWSERRNAVASVVAGILFFTGWWIMIDAAVVYPKPEQLNHAFHT CGVFSTLAFFMINAVSNAQVRGDSYESGCLGRTGARVWLFIGFMLMFGSLIASMWILFGA YVTQNTDVYPGLAVFFQNALIFFSTLIYKFGRTEELWT
Uniprot No.

Target Background

Database Links
Protein Families
UPF0220 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What are the optimal conditions for recombinant expression of bovine TMEM50B?

For optimal recombinant expression of bovine TMEM50B:

  • Expression System: E. coli is the most commonly used expression system for producing recombinant TMEM50B with high yield .

  • Vector Considerations: Vectors containing N-terminal His tags have shown superior results for purification and stability.

  • Purification Protocol: Affinity chromatography using Ni-NTA resins is effective, yielding >90% purity as determined by SDS-PAGE .

  • Storage Conditions: The purified protein should be stored as follows:

    • Lyophilized powder form for long-term storage

    • Store at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use

    • Avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution Recommendations: Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol (final concentration) .

How can researchers effectively validate antibody specificity for bovine TMEM50B?

Validating antibody specificity for bovine TMEM50B requires a multi-step approach:

  • Western Blot Analysis:

    • Use recombinant bovine TMEM50B protein as a positive control

    • Compare with tissue extracts known to express TMEM50B

    • Expect a band at approximately 17-20 kDa (depending on tag size)

  • Cross-Reactivity Testing:

    • Test against related proteins (particularly TMEM50A, its closest paralog)

    • Include negative controls from tissues not expressing the target

    • Perform peptide competition assays using the immunogenic peptide sequence

  • Immunocytochemistry Validation:

    • Transfect cells with TMEM50B expression vectors

    • Compare staining patterns with subcellular markers for the endoplasmic reticulum

    • Include knockout/knockdown controls where possible

  • Array Validation:

    • Some commercial antibodies are validated on protein arrays containing target protein plus 383 other non-specific proteins

    • An antibody should recognize the target with >10x signal compared to non-specific binding

For immunocytochemistry applications, optimal working dilutions are typically 1-4 μg/ml .

What methodologies are recommended for studying TMEM50B gene expression in bovine tissues?

For comprehensive analysis of TMEM50B expression in bovine tissues:

  • RNA-Seq Approach:

    • Use poly-A selection to enrich mRNA

    • Implement appropriate quality control measures (>90% mapped reads)

    • Normalize expression values using established methods (FPKM, TPM, or counts per million)

    • Include tissue-specific controls to establish baseline expression levels

  • RT-qPCR Protocol:

    • Design primers spanning exon-exon junctions to avoid genomic DNA amplification

    • Recommended primer regions should target conserved sequences in exons

    • Use appropriate reference genes for bovine tissue (GAPDH, ACTB, or 18S rRNA)

    • Implement the 2^-ΔΔCt method for relative quantification

  • Single-Cell RNA-Seq for Developmental Studies:

    • For embryonic studies, Single-Cell RNA Barcoding and Sequencing (SCRB-Seq) has been successfully applied

    • Quality control should include filtering cells with <2,000 unique molecular identifiers (UMI)

    • Analyze expression patterns using pseudotime trajectory analysis tools like CellTree

  • Western Blot for Protein Expression:

    • Use 12% Bis-Tris Gel/MOPS for optimal separation

    • Transfer onto PVDF membranes electrophoretically for 2 hours

    • Block with 5% skimmed milk for 1.5 hours before antibody incubation

How is TMEM50B regulated at the transcriptional level, and what are the implications for research design?

TMEM50B exhibits complex transcriptional regulation that should be considered in experimental design:

  • Interferon (IFN) Regulation:

    • TMEM50B contains multiple interferon-stimulated response elements (ISREs) and gamma-activated sequence (GAS) elements in its promoter region

    • Specifically, it has one ISRE and two GAS sequences that regulate its expression

    • One GAS sequence represents the control site for ICAM1 and is a complete sequence

    • The other GAS sequence represents the control site for the indole 2,3 oxygenase gene INDO

    • The ISRE found is a control site for GIP2, located approximately 6000 base pairs upstream

  • Chemical Response Elements:

    • Multiple chemicals affect TMEM50B expression, including:

      • 2,3,7,8-tetrachlorodibenzodioxine (increases expression)

      • 17beta-estradiol (decreases expression)

      • 1,2-dimethylhydrazine (decreases expression)

  • Co-expression Network Analysis:

    • TMEM50B can be analyzed using Weighted Correlation Network Analysis (WGCNA)

    • This approach identifies differentially co-expressed modules (DcoEx) of genes

    • Selection of soft-thresholding power based on scale-free topology is critical

    • For proper analysis, select the first soft-thresholding power to reach a scale-free topology model fit ≥0.8

These regulatory elements suggest that experimental designs should control for interferon signaling status and inflammatory conditions when studying TMEM50B expression.

What role does TMEM50B play in bovine embryonic development and how can this be studied?

TMEM50B has been implicated in embryonic development with specific methodological approaches for study:

  • Expression Pattern Analysis:

    • TMEM50B shows expression during early embryonic stages from NF stage 7 to NF stage 66

    • It is expressed in various tissues including animal cap, brain, ectoderm, head, limb, skeletal muscle, and testis

  • Single-Cell Transcriptomics Approach:

    • For studying bovine embryo development, single-cell RNA-Seq can capture developmental trajectories

    • Key methodology includes:

      • Isolating individual blastomeres without contamination

      • Using unique molecular identifiers (UMI) for accurate quantification

      • Implementing Bayesian mixture models (Latent Dirichlet Allocation) to identify different developmental topics

  • Functional Studies via CRISPR-Cas9:

    • Design guide RNAs targeting conserved exons of TMEM50B

    • Validate knockouts via sequencing and Western blot

    • Assess phenotypic consequences through morphological analysis and developmental milestone tracking

  • Epigenetic Regulation:

    • Cut&Tag chromatin profiling can be used alongside RNA-Seq to understand epigenetic regulation

    • This combined approach has been successful in studying metabolically challenging conditions in early bovine embryo development

How does TMEM50B interact with cellular signaling pathways, and what experimental approaches can elucidate these interactions?

TMEM50B has been implicated in several signaling pathways, which can be investigated through:

  • Protein-Protein Interaction Studies:

    • Immunoprecipitation followed by mass spectrometry (IP-MS) to identify binding partners

    • Proximity labeling methods (BioID or APEX) to identify proteins in close proximity to TMEM50B in its native cellular environment

    • Yeast two-hybrid screening using the cytoplasmic domains as bait

  • Signaling Pathway Analysis:

    • TMEM50B has been identified in gene correlation network analyses as potentially regulated by:

      • EGFR pathway (alongside genes like BIRC5, CCNA2, CXCL5, E2F1)

      • HSF1 pathway (alongside CCT4, FKBP4, HSF2, HSP90AA1)

      • PGR pathway (alongside AK3, HES1, HPGD, ITGA6)

    Gene IDMapped Candidate ModulesRegulated ModuleTarget GenesAdjusted p-Value
    EGFRDarkgreen HFTurquoise HFBIRC5, CCNA2, CXCL5, E2F1, etc.0.003
    EGFRDarkgreen HFCyan HFCCT5, EIF5A, EPS15, GADD45A, etc.0.003
    PGRTurquoise HFTurquoise HFAK3, HES1, HPGD, ITGA6, etc.0.047
  • Functional Genomics Screen:

    • CRISPR-based screens to identify genes that show synthetic lethality or rescue phenotypes with TMEM50B

    • Phosphoproteomic analysis after TMEM50B perturbation to identify affected phosphorylation cascades

  • Structural Biology Approaches:

    • Cryo-EM or X-ray crystallography to determine protein structure and identify potential interaction domains

    • Molecular dynamics simulations to predict protein behavior in membrane environments

What are the differences between alternative splicing isoforms of TMEM50B, and how do they affect protein function?

Studies on TMEM gene families have identified alternative splicing variants with distinct functional properties:

  • Isoform Identification Methods:

    • RT-PCR with primers designed to span potential splice junctions

    • Full-length cDNA sequencing using platforms like PacBio or Nanopore

    • RNA-Seq analysis with algorithms specifically designed to detect alternative splicing events

  • Functional Domain Analysis:

    • Similar to studies on TMEM95, TMEM50B may contain conserved domains affected by splicing

    • Bioinformatic analysis can predict if isoforms contain functional domains such as:

      • Leucine-rich repeat C-terminal domains (involved in protein interactions)

      • IZUMO domains (related to membrane fusion processes)

      • Signal peptides affecting cellular localization

  • Tissue-Specific Expression Patterns:

    • qRT-PCR protocols for isoform-specific quantification should:

      • Use primers spanning unique exon-exon junctions

      • Include appropriate reference genes

      • Validate specificity using plasmids containing individual isoforms

  • Functional Characterization:

    • Express individual isoforms in cellular models

    • Assess subcellular localization through immunofluorescence

    • Evaluate functional differences through rescue experiments in knockout models

    • Analyze protein-protein interactions unique to each isoform

How does the genomic context of TMEM50B on chromosome 21 impact its function in trisomy conditions, and what experimental designs can address this question?

TMEM50B's location on chromosome 21 raises important questions about its role in trisomy conditions:

  • Dosage Effect Analysis:

    • TMEM50B is located on chromosome 21q22.11, making it subject to dosage effects in trisomy 21

    • It contains regulatory elements responsive to interferon signaling, which may contribute to immune dysregulation in Down syndrome

    • Research design should include:

      • Comparison of expression levels in diploid vs. trisomic cells

      • Analysis of downstream pathway activation

      • Rescue experiments to normalize expression levels

  • Interferon Hypersensitivity Connection:

    • TMEM50B has been identified as potentially IFN-regulated due to containing:

      • At least two ISRE sequences

      • One GAS control site upstream of its transcription start site

    • This qualifies it as an IFN-regulated gene that may contribute to autoimmune predisposition

  • Experimental Models:

    • iPSC-derived cells from individuals with trisomy 21

    • CRISPR-engineered trisomy models in relevant cell types

    • Mouse models (Ts65Dn) that recapitulate aspects of human trisomy 21

  • Multi-omics Integration:

    • Integrated analysis of:

      • Transcriptomics to measure expression levels

      • Proteomics to assess protein abundance

      • Phosphoproteomics to evaluate signaling effects

      • Metabolomics to identify downstream metabolic consequences

What are common challenges in working with recombinant TMEM50B protein, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant TMEM50B:

  • Protein Solubility Issues:

    • Challenge: As a transmembrane protein, TMEM50B tends to aggregate during expression and purification

    • Solutions:

      • Express as fusion proteins with solubility-enhancing tags (MBP, SUMO)

      • Use mild detergents like n-Dodecyl-β-D-maltoside (DDM) or CHAPS during purification

      • Optimize buffer conditions with glycerol (5-50%) and salt concentration

  • Low Expression Yields:

    • Challenge: Membrane proteins often express poorly in bacterial systems

    • Solutions:

      • Lower induction temperature (16-18°C)

      • Use specialized E. coli strains (C41(DE3), C43(DE3)) designed for membrane protein expression

      • Consider alternative expression systems (insect cells, mammalian cells) for complex folding requirements

  • Protein Stability During Storage:

    • Challenge: TMEM50B may denature during freeze-thaw cycles

    • Solutions:

      • Store in buffer containing 6% trehalose at pH 8.0

      • Aliquot before freezing to avoid repeated freeze-thaw cycles

      • For reconstituted protein, add 5-50% glycerol before storage at -20°C/-80°C

  • Functional Assay Development:

    • Challenge: Confirming proper folding and function of recombinant protein

    • Solutions:

      • Circular dichroism (CD) spectroscopy to verify secondary structure

      • Binding assays with known interacting partners

      • Incorporation into liposomes to assess membrane integration

How can researchers address discrepancies in TMEM50B expression data between different experimental platforms?

When facing conflicting data about TMEM50B expression from different experimental approaches:

  • Platform-Specific Biases:

    • Microarray vs. RNA-Seq discrepancies:

      • RNA-Seq typically has better dynamic range and can detect novel isoforms

      • Microarrays may miss specific splice variants depending on probe design

      • Resolution: Validate key findings with targeted RT-qPCR using isoform-specific primers

  • Sample Preparation Variables:

    • Different tissue preservation methods can affect RNA quality

    • Cell culture conditions (confluence, passage number) impact expression profiles

    • Resolution: Standardize sample collection protocols and include detailed metadata reporting

  • Data Normalization Approaches:

    • When integrating diverse datasets:

      • Apply batch correction methods (ComBat, Surrogate Variable Analysis)

      • Use relative ranking methods rather than absolute expression values

      • Consider platform-specific normalization approaches before comparison

  • Biological vs. Technical Variation:

    • Distinguish between:

      • True biological variability (genetic background, developmental stage)

      • Technical artifacts (library preparation, sequencing depth)

    • Resolution: Include biological replicates (n≥3) and appropriate controls

  • Single-Cell vs. Bulk Analysis:

    • Single-cell data may reveal cell type-specific expression masked in bulk analysis

    • Resolution: Use deconvolution methods for bulk data or validate with spatial transcriptomics approaches

What emerging technologies are most promising for elucidating TMEM50B function in bovine biology?

Several cutting-edge technologies show particular promise for advancing TMEM50B research:

  • Spatial Transcriptomics:

    • Technologies like Visium, MERFISH, or seqFISH+ can map TMEM50B expression within intact tissue contexts

    • This would clarify cell type-specific expression patterns and potential regional specialization

    • Particularly valuable for developmental studies and tissue-specific function analysis

  • Proteomics Advances:

    • Targeted proteomics using parallel reaction monitoring (PRM) for accurate quantification

    • Proximity labeling methods (TurboID, APEX2) to identify protein interaction networks in native contexts

    • Cross-linking mass spectrometry (XL-MS) to capture transient interactions

  • Organoid Models:

    • Bovine organoid systems from relevant tissues expressing TMEM50B

    • Applications include:

      • Studying protein function in a physiologically relevant 3D environment

      • CRISPR-based functional genomics in a tissue-specific context

      • Drug screening for compounds modulating TMEM50B function

  • Multi-modal Single-Cell Omics:

    • Combined single-cell RNA and protein analysis (CITE-seq)

    • Single-cell ATAC-seq for epigenetic regulation

    • Multimodal analysis revealing connections between transcription, chromatin accessibility, and protein expression

How might TMEM50B research contribute to our understanding of comparative membrane biology across species?

TMEM50B research offers several opportunities for advancing comparative membrane biology:

  • Evolutionary Conservation Analysis:

    • TMEM50B has homologs across diverse species including human, mouse, rat, fish, and others

    • Alignment of protein sequences across species reveals:

      • Highly conserved transmembrane domains suggesting critical functional importance

      • Variable regions that may confer species-specific functions

      • Opportunity to identify conserved interaction motifs and functional domains

  • Structure-Function Relationships:

    • Comparative structural biology approaches can:

      • Identify conserved structural features despite sequence divergence

      • Reveal binding pockets or interaction surfaces maintained through evolution

      • Inform targeted mutagenesis experiments to test functional hypotheses

  • Tissue-Specific Expression Patterns:

    • Cross-species comparison of expression patterns can:

      • Highlight conserved vs. divergent regulatory mechanisms

      • Identify lineage-specific adaptations in protein function

      • Reveal fundamental principles of membrane protein biology

  • Methodological Considerations:

    • When designing cross-species studies:

      • Use orthologous protein regions for antibody generation

      • Design primers in conserved regions for gene expression studies

      • Consider codon optimization when expressing proteins from different species

      • Account for differences in post-translational modifications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.