Recombinant Bovine Transmembrane protein 59-like (TMEM59L)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM59L; Transmembrane protein 59-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-349
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
TMEM59L
Target Protein Sequence
APPVRDPFALQLGDTQNCQLRCRDRYPKPQLAQEELGEDPIQSRRAKAYDRAVLTSACER GCRLFSICRFVARSSKPNATQAECEAACVEAYVKETEQQACSEGCWSQNPEPEPEPELEQ KRKVLEAPSGALSLLDLFSTLCNDLVNSAQGFVSSTWTYYLQTDNGKVVVFQTQPVVESL GHEGARLQRVEVTWRGSHPEALEVHVDPVGPLDKVRKAKIRVKTSSKAKVESDELQDNDF LSCMSRRSGLPRWILACCLFLSVLVMLWLSCSTLVTAPGQHLKFQPLTLEQHKGYMVEPE WSLYPPPSHAYADSPPPYKLKLDLTKL
Uniprot No.

Target Background

Function

This recombinant Bovine Transmembrane protein 59-like (TMEM59L) modulates O-glycosylation and complex N-glycosylation during Golgi-mediated APP maturation. It inhibits APP transport to the cell surface and subsequent shedding.

Database Links
Protein Families
TMEM59 family
Subcellular Location
Golgi apparatus membrane; Single-pass type I membrane protein.

Q&A

What is the basic structure and function of bovine TMEM59L?

Bovine TMEM59L is a type I transmembrane protein with brain-specific expression. The protein contains a single transmembrane domain, with an extracellular N-terminus and an intracellular C-terminus. Functionally, TMEM59L regulates the levels of Rab GDP dissociation inhibitor (GDI) protein family and affects cell membrane transport mechanisms. The protein is highly conserved among different species, with approximately 75% identity between human and mouse TMEM59L . For structural analysis, the protein can be evaluated through standard protein characterization methods including SDS-PAGE with Coomassie staining to confirm purity (typically >80%) .

What expression systems are recommended for producing recombinant bovine TMEM59L?

Based on available literature, bacterial expression systems (specifically E. coli) have been successfully used for producing recombinant TMEM59L protein . When designing expression constructs, researchers should consider:

  • Including a His-tag (typically N-terminal) for purification purposes

  • Using a strong promoter (such as T7) for efficient expression

  • Optimizing codons for bacterial expression if necessary

  • Including appropriate fusion partners to improve solubility

Purification can be achieved through immobilized metal affinity chromatography (IMAC) with buffers containing PBS and 1M urea (pH 7.4) to maintain protein stability .

What are the optimal storage conditions for maintaining the stability of recombinant TMEM59L?

For optimal stability, recombinant TMEM59L should be stored at -20°C and researchers should avoid repeated freeze-thaw cycles . For working solutions, the protein is typically maintained in PBS containing 1M urea at pH 7.4. If protein aggregation is observed, consider adding glycerol (10-15%) to the storage buffer. For long-term storage of larger batches, aliquoting the protein before freezing is recommended to avoid degradation from repeated freeze-thaw cycles.

What cellular assays can be used to study TMEM59L function in autophagy regulation?

To assess TMEM59L's role in autophagy, researchers can employ several methodological approaches:

  • LC3 lipidation assays: Monitor the conversion of LC3-I to LC3-II by Western blotting following TMEM59L overexpression or knockdown. This can be performed with or without lysosomal inhibitors (bafilomycin or E64d/pepstatin) to evaluate autophagic flux .

  • GFP-LC3 redistribution assays: Transfect cells with GFP-LC3 and assess vesicular redistribution using fluorescence microscopy after modulating TMEM59L expression .

  • Colocalization studies: Use fluorescently tagged TMEM59L and autophagy markers (LC3, ATG16L1) to evaluate their interaction in vesicular structures, particularly following bacterial challenges such as S. aureus infection .

  • ATG16L1 interaction assays: Perform co-immunoprecipitation experiments to detect binding between TMEM59L and ATG16L1, focusing on the 19-amino acid motif (equivalent to amino acids 263-281 in human TMEM59) that has been shown to mediate this interaction .

How can researchers investigate TMEM59L's role in apoptosis and oxidative stress response?

To examine TMEM59L's involvement in apoptosis and oxidative stress, implement the following experimental approaches:

  • Caspase activation assays: Measure caspase-3 activation using fluorogenic substrates or Western blotting for cleaved caspase-3 after TMEM59L overexpression or knockdown .

  • Oxidative stress models: Challenge cells with hydrogen peroxide (H₂O₂) after modulating TMEM59L expression, then assess cell viability using MTT or similar assays .

  • Mitochondrial integrity assessment: Isolate mitochondria using fractionation techniques and evaluate mitochondrial membrane potential changes using JC-1 or TMRM dyes in response to TMEM59L manipulation .

  • Genomic approaches: Perform RNA-Seq analysis to identify differentially expressed genes in oxidative stress pathways following TMEM59L modulation, comparing results with the known human TMEM59L response patterns .

How does TMEM59L influence amyloid precursor protein (APP) processing and what implications does this have for neurodegeneration research?

TMEM59L has been shown to significantly impact APP processing through several mechanisms:

  • Inhibition of cell membrane transport: TMEM59L overexpression markedly increases intracellular APP levels by inhibiting its transport to the cell membrane .

  • Modulation of glycosylation: TMEM59L affects both O-glycosylation and complex N-glycosylation steps during Golgi maturation of APP, similar to its homolog TMEM59 .

To investigate these effects experimentally:

  • Perform pulse-chase experiments with labeled APP after TMEM59L manipulation

  • Analyze APP glycosylation patterns using glycosidase treatments and Western blotting

  • Assess APP localization through subcellular fractionation and immunofluorescence microscopy

  • Measure APP cleavage products (sAPPα, sAPPβ, Aβ) using ELISA or Western blotting approaches

These methods can help determine if bovine TMEM59L influences APP processing in ways similar to its human counterpart, with potential implications for neurodegeneration research .

What is the role of TMEM59L in synaptic refinement and how might this relate to neurodevelopmental disorders?

Recent research has revealed TMEM59 (a homolog of TMEM59L) plays an important role in synaptic refinement through microglial phagocytosis of synapses:

  • TMEM59 interacts with C1q receptor CD93 in microglia, facilitating synapse engulfment .

  • TMEM59 deficiency leads to impaired phagocytosis of excitatory synapses, resulting in increased dendritic spine density and enhanced excitatory synaptic transmission .

  • These changes are associated with autism spectrum disorder (ASD)-like behaviors in animal models .

To investigate if bovine TMEM59L exhibits similar functions, researchers could:

  • Assess TMEM59L expression in microglial cells from bovine brain tissue

  • Perform knockdown experiments using siRNA or CRISPR-Cas9 in primary bovine microglial cultures

  • Evaluate synapse engulfment capacity through immunofluorescence for synaptic markers

  • Analyze potential binding partners (especially CD93) through co-immunoprecipitation studies

Such investigations could provide valuable insights into the comparative neurodevelopmental functions of TMEM59L across species .

How can bovine TMEM59L be used as a model for understanding human neurological conditions?

Bovine TMEM59L can serve as a valuable model for investigating human neurological conditions through several approaches:

  • Comparative functional studies: Assess whether bovine TMEM59L exhibits similar neuroprotective or neurodegenerative effects as human TMEM59L in oxidative stress conditions using primary bovine neuronal cultures .

  • Animal models: Create transgenic mouse models expressing bovine TMEM59L and evaluate behavioral phenotypes related to anxiety, depression, and memory, which have been linked to TMEM59L function .

  • Molecular pathway analysis: Compare the interaction partners and downstream signaling pathways of bovine and human TMEM59L, particularly focusing on:

    • Autophagy pathways (ATG16L1 interaction)

    • Apoptotic cascades (caspase activation)

    • APP processing machinery (glycosylation and trafficking)

  • Drug response studies: Evaluate how modulation of TMEM59L activity affects response to neuroprotective compounds in bovine versus human neuronal models .

How does TMEM59L regulate the GDI protein family and what implications does this have for vesicular trafficking?

TMEM59L has been shown to significantly increase the levels of Rab GDP dissociation inhibitor alpha and Rab GDP dissociation inhibitor beta proteins . This regulatory mechanism has important implications for vesicular trafficking:

  • Mechanistic investigation approaches:

    • Perform co-immunoprecipitation studies to determine if TMEM59L directly interacts with GDI proteins

    • Use proximity ligation assays to confirm interactions in intact cells

    • Conduct pulse-chase experiments to determine if TMEM59L affects GDI protein stability or synthesis rates

  • Functional consequences:

    • GDI proteins regulate the cycling of Rab GTPases between membranes and cytosol

    • Increased GDI levels could sequester Rab proteins in the cytosol, inhibiting membrane trafficking

    • This mechanism may explain TMEM59L's observed inhibition of APP transport to the cell surface

  • Experimental validation:

    • Utilize fluorescently tagged cargo proteins to track vesicular transport in real-time after TMEM59L manipulation

    • Quantify Rab protein membrane association through subcellular fractionation

    • Measure vesicle budding and fusion events using in vitro reconstitution assays

Understanding this regulatory axis could provide insights into fundamental membrane trafficking mechanisms with implications for protein secretion, receptor recycling, and organelle biogenesis .

How can researchers analyze TMEM59L's role in cancer progression based on recent genomic findings?

Recent studies have identified potential roles for TMEM59L in cancer progression . Researchers can investigate these functions through several sophisticated approaches:

  • Transcriptomic profiling:

    • Analyze TMEM59L expression across cancer types and correlate with clinical outcomes

    • Examine TMEM59L expression in relation to tumor stage and molecular subtypes

    • Recent findings indicate that TMEM59L expression correlates with later pathological stages in KIRP, BLCA, COAD, and KIRC

  • Methylation analysis:

    • Assess methylation patterns of the TMEM59L gene promoter in different cancers

    • Correlate methylation status with expression levels and clinical parameters

    • Recent data suggest methylation dynamics may regulate TMEM59L expression in cancers

  • Immune microenvironment interaction:

    • Investigate correlations between TMEM59L expression and immune infiltration using CIBERSORT algorithm

    • Evaluate associations with immunophenoscore (IPS) and expression of immunomodulators

    • TMEM59L has shown significant correlations with immune parameters in various cancers

  • Functional validation:

    • Perform TMEM59L knockdown or overexpression in bovine or human cancer cell lines

    • Assess effects on hallmarks of cancer including proliferation, migration, invasion, and drug response

    • Target validation studies have identified potential therapeutic agents that may target TMEM59L in cancers

These approaches can help determine if bovine TMEM59L exhibits similar cancer-related functions as its human counterpart .

What are the common challenges in working with recombinant TMEM59L and how can they be addressed?

Researchers working with recombinant TMEM59L may encounter several technical challenges:

  • Protein solubility issues:

    • Challenge: As a transmembrane protein, TMEM59L may exhibit poor solubility when expressed recombinantly

    • Solution: Express the protein without the transmembrane domain or use appropriate detergents/solubilizing agents during purification

    • Alternative: Use fusion tags such as MBP or SUMO to enhance solubility

  • Protein degradation:

    • Challenge: TMEM59L undergoes active lysosomal degradation in cells

    • Solution: Include protease inhibitors during all steps of purification

    • Validation: Monitor protein integrity by Western blotting during storage and experimentation

  • Post-translational modifications:

    • Challenge: Bacterial expression systems lack the machinery for glycosylation

    • Solution: For studies requiring glycosylated protein, consider mammalian or insect cell expression systems

    • Assessment: Use tunicamycin treatment to verify N-glycosylation sites (N97 in human TMEM59L)

  • Functional activity verification:

    • Challenge: Confirming that recombinant protein retains native functionality

    • Solution: Develop activity assays based on known functions (e.g., ATG16L1 binding assays)

    • Control: Include mutations in key functional domains (e.g., ATG16L1-binding motif) as negative controls

What methodological approaches can be used to study the interaction between TMEM59L and ATG16L1 in autophagy regulation?

To investigate the TMEM59L-ATG16L1 interaction that regulates autophagy, researchers can employ several sophisticated approaches:

  • Binding domain mapping:

    • Methodology: Generate truncation constructs of TMEM59L focusing on the 19-amino acid motif region (amino acids 263-281 in human TMEM59) shown to be critical for ATG16L1 binding

    • Readout: Use co-immunoprecipitation or pull-down assays to determine minimal binding regions

    • Validation: Create point mutations in critical residues within the binding motif to confirm specificity

  • Interaction visualization in cells:

    • Methodology: Implement proximity ligation assays (PLA) or fluorescence resonance energy transfer (FRET) to detect TMEM59L-ATG16L1 interactions in intact cells

    • Application: Monitor interaction dynamics during cellular stress conditions or bacterial challenges

    • Controls: Include non-interacting protein pairs and binding-deficient mutants

  • Structural analysis:

    • Approach: Express and purify the minimal interacting domains of both proteins for co-crystallization studies

    • Alternative: Use hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • Validation: Confirm structural insights through mutagenesis of predicted interface residues

  • Functional consequence assessment:

    • Methodology: Reconstitute LC3 lipidation assays in vitro using purified components including TMEM59L, ATG16L1, and core autophagy machinery

    • Readout: Measure LC3 lipidation efficiency in the presence of wild-type versus binding-deficient TMEM59L

    • Application: Test if selective bacterial autophagy (xenophagy) requires this interaction using S. aureus infection models

These methodological approaches can provide mechanistic insights into how TMEM59L regulates autophagy through ATG16L1 interaction, with implications for both physiological processes and bacterial defense mechanisms .

How might TMEM59L be involved in the bovine immune response to intracellular pathogens?

Recent research has revealed that TMEM59 plays a critical role in autophagy activation in response to S. aureus infection . Investigators studying bovine TMEM59L's role in immune responses should consider:

  • Infection models:

    • Methodology: Challenge bovine mammary epithelial cells (MAC-T cells) with intracellular S. aureus after TMEM59L manipulation

    • Readout: Measure bacterial clearance, LC3 lipidation, and autophagosome formation

    • Validation: Research has shown that S. aureus infection triggers autophagy responses in bovine mammary epithelial cells

  • Pathway analysis:

    • Approach: Perform RNA-Seq on bovine cells with modulated TMEM59L expression during bacterial challenge

    • Focus: Analyze changes in immune response genes, particularly autophagy and inflammation pathways

    • Context: Previous studies have identified differential gene expression in bovine cells following S. aureus infection

  • Protein interaction studies:

    • Methodology: Assess TMEM59L interaction with bovine ATG16L1 during bacterial challenge

    • Technique: Co-immunoprecipitation followed by mass spectrometry to identify additional binding partners

    • Significance: This interaction is critical for targeting bacteria for LC3 lipidation and subsequent clearance

  • Translational implications:

    • Application: Develop strategies to enhance TMEM59L-mediated autophagy against intracellular pathogens

    • Relevance: S. aureus is a major causative agent of bovine mastitis, an economically significant disease

    • Approach: Screen for compounds that enhance TMEM59L expression or activity in bovine mammary tissue

These research directions could provide valuable insights into bovine immunity and potential therapeutic strategies for intracellular bacterial infections .

What potential exists for TMEM59L as a therapeutic target in neurodegenerative conditions?

The involvement of TMEM59L in APP processing, oxidative stress response, and neuronal apoptosis suggests significant therapeutic potential :

  • Target validation approaches:

    • Methodology: Use AAV-mediated knockdown of TMEM59L in animal models of neurodegeneration

    • Assessment: Evaluate effects on disease progression, behavior, and molecular markers

    • Evidence: Previous studies have shown that downregulation of TMEM59L protects neurons against oxidative stress and improves behavioral outcomes

  • Mechanism-based drug screening:

    • Approach: Develop high-throughput assays based on TMEM59L's interaction with key partners (ATG16L1, APP)

    • Strategy: Screen for compounds that modulate these interactions or TMEM59L expression

    • Readout: Measure neuroprotection in oxidative stress models or effects on APP processing

  • Biomarker development:

    • Methodology: Assess TMEM59L levels or post-translational modifications in biological fluids

    • Application: Correlate with disease progression or treatment response

    • Rationale: TMEM59L's dynamic expression during development suggests potential regulatory mechanisms that could be leveraged therapeutically

  • Combination therapy approaches:

    • Strategy: Target TMEM59L in conjunction with established neurodegenerative disease therapies

    • Rationale: TMEM59L modulates multiple pathways relevant to neurodegeneration (APP processing, oxidative stress response)

    • Methodology: Test synergistic effects in cellular and animal models of neurodegeneration

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.