Recombinant Bovine Transmembrane protein 68 (TMEM68)

Shipped with Ice Packs
In Stock

Description

Introduction

Transmembrane protein 68 (TMEM68) is an endoplasmic reticulum (ER)-anchored acyltransferase family member whose function was previously unknown . It participates in the triglyceride biosynthetic process and is active in the endoplasmic reticulum membrane . TMEM68 functions as an acyltransferase and affects glycerolipid metabolism, lipogenic gene expression, and triacylglycerol (TG) storage in mammalian cells .

Basic Information

The TMEM88 gene is located at position p13.1 on chromosome 17 and consists of 1214 bases on the plus strand. The corresponding TMEM88 protein is composed of 159 amino acid residues, with a molecular weight of 17251 Da .

Function and Mechanism

TMEM68 promotes TG synthesis and lipid droplet formation independently of acyl-CoA:diacylglycerol acyltransferase (DGAT) . Overexpression of TMEM68 promotes TG accumulation and lipid droplet (LD) formation in a conserved active sites-dependent manner . TMEM68 affects the levels of several glycerophospholipids, such as phosphatidylcholine, phosphatidylethanolamine and phosphatidylinositol, as well as sterol ester contents .

A mutant TMEM68 (mtTMEM68) containing H129A and D135N does not affect cellular TG levels, suggesting that TMEM68 increases TG accumulation in an enzyme active sites-dependent manner . More LDs accumulate in TMEM68-expressing cells after transient transfection compared with the less dispersed LDs in the adjacent cells lacking TMEM68 expression . HEK293 cells stably expressing TMEM68 contain more LDs as compared to 293/GFP cells even without oleic acid (OA) supplementation .

Impact on Lipid Metabolism

Quantitative targeted lipidomic analysis shows that TMEM68 overexpression can significantly increase total TG levels . The cellular levels of diacylglycerol (DG) and free fatty acid (FFA), the precursors of TG biosynthesis, also significantly increase upon overexpression of TMEM68, but TMEM68 overexpression does not alter MG levels . The acylcarnitine level decreases due to overexpression of TMEM68 .

Overexpression of TMEM68 increases the content of several DG species and FFAs, while decreasing polyunsaturated DG and FFAs containing arachidonic acid .

Role in Tumors

The TMEM88 protein is found in a variety of tumors, but its functions vary depending on tissue and subcellular locations . Cytoplasmic localization of TMEM88 is positively correlated with the TNM stage and lymph node metastasis in triple-negative breast cancer, whereas nuclear localization is negatively correlated with lymph node metastasis in nontriple-negative breast cancer . In ovarian cancer, TMEM88 downregulates the levels of c-Myc and Cyclin D1, thereby inhibiting the proliferation of ovarian cancer cells . High expression of TMEM88 in non-small-cell lung cancer (NSCLC) is positively correlated with a better prognosis for patients .

TMEM88 expression was higher in NSCLC tissue than in normal lung tissue . Overexpression of TMEM88 can inhibit the excessive proliferation, invasion, and migration of LK2 cells, thus preventing the growth of transplanted tumors in nude mice . The degree of TMEM88 methylation in NSCLC tissues is higher than in normal tissues . TMEM88 was significantly reduced in thyroid cancer . Restoration of TMEM88 can markedly suppress the proliferation, colony formation, and invasion ability of thyroid cancer cells, while depletion of TMEM88 can accelerate the proliferation and invasion ability of thyroid cancer cells . Overexpression of TMEM88 exhibits a certain inhibitory action on bladder cancer cell growth and tumor formation .

Involvement in Signaling Pathways

TMEM88 can regulate the Wnt/β-catenin signaling pathway, which affects tumor cell proliferation, metastasis, and host antitumor immunity . TMEM88 is closely correlated with the mRNA expression levels of c-Myc and β-catenin mRNA . Overexpression of TMEM88 significantly reduces the transcriptional activity of TCF/LEF and inhibits the expression of the downstream target genes c-Myc and cyclin D1 of the Wnt/β-catenin signaling pathway . Reactivation of Wnt/β-catenin signaling partially reversed the inhibitory effect of TMEM88 on the proliferation and invasion of thyroid cancer cells, indicating that TMEM88 exerts an anti-thyroid cancer effect in the presence of Wnt/β-catenin protein signaling . Overexpression of TMEM88 also inhibited the activation of the Wnt/β-catenin signaling pathway by reducing the phosphorylation level of GSK-3β (Ser9 site) .

Table 1: TMEM88 Functions in Different Tissues

TissueFunction
Triple-Negative Breast CancerCytoplasmic localization is positively correlated with TNM stage and lymph node metastasis.
Non-Triple-Negative Breast CancerNuclear localization is negatively correlated with lymph node metastasis.
Ovarian CancerDownregulates the levels of c-Myc and Cyclin D1, thereby inhibiting the proliferation of ovarian cancer cells.
Non-Small-Cell Lung CancerHigh expression is positively correlated with a better prognosis of patients. Overexpression inhibits proliferation, invasion, and migration of LK2 cells.
Thyroid CancerExpression levels are significantly decreased. Restoration of TMEM88 suppresses proliferation, colony formation, and invasion ability.
Bladder CancerOverexpression exhibits an inhibitory action on cell growth and tumor formation.

Table 2: Impact of TMEM68 Overexpression on Lipid Metabolism

Lipid MetaboliteEffect of TMEM68 Overexpression
Total TG LevelsSignificantly increased (10-fold compared to control cells).
DG LevelsSignificantly increased.
FFA LevelsSignificantly increased.
MG LevelsNo alteration observed.
Acylcarnitine LevelDecreased.
DG SpeciesIncreased content of several species, particularly those containing unsaturated palmitoleyl- or oleoyl- moieties. Polyunsaturated DG (16:1_22:6) decreased.
FFAsIncreased saturated and monounsaturated FFAs. Reduced polyunsaturated FFAs containing arachidonic acid (FFA (20:4)).

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
TMEM68; Transmembrane protein 68
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-334
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM68
Target Protein Sequence
MTNKNQSFGVGQDSMSSMTCLIHVLEAWFGVEHLEDYWNFANYLLWVFTPLLLLILPYFT IFLLYLTIIFLHIYKRKNVLKEAYSHNLWDGARKTVATLWDGHAAVWHGYEVHGMEKIPE EGPALIIFYHGAIPIDFYYFMAKIFIHKGRTCRVVADHFVFKIPGFSLLLDVFCAIHGPR EKCVEILQSGHLLAISPGGVREALMSDETYNIVWGNRKGFAQVAIDAKVPIIPMFTQNIR EGFRSLGGTRLFRWLYEKFRYPFAPMYGGFPVKLRTYLGDPIPYDPKITAEELAEKTKDA VQALIDKHQRIPGNIMSALLERFRNKQKINQKTL
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM68 and where is it localized in cells?

TMEM68 (Transmembrane protein 68) is an integral membrane protein that belongs to the glycerophospholipid acyltransferase family. It is primarily localized in the endoplasmic reticulum (ER) membrane, but not at cellular lipid droplets (LDs) . The protein contains two transmembrane domains with both N- and C-termini oriented toward the cytosol, as demonstrated through protease protection assays . TMEM68 is also known as DIESL or MGAT/DGAT in scientific literature, reflecting its enzymatic activities in lipid metabolism .

What is the primary function of TMEM68?

TMEM68 functions as an acyltransferase involved in triacylglycerol (TAG) biosynthesis. It catalyzes the formation of triacylglycerol from diacylglycerol (DAG) and membrane phospholipids, particularly phosphatidylcholine (PC) and its ether-linked form (ePC) . Recent studies have shown that TMEM68 exhibits both monoacylglycerol acyltransferase (MGAT) and diacylglycerol acyltransferase (DGAT) activities in vitro, dependent on conserved active sites . Overexpression of TMEM68 promotes TAG accumulation and lipid droplet formation in a manner dependent on these conserved active sites .

How can researchers express and purify recombinant bovine TMEM68?

Recombinant bovine TMEM68 can be expressed using prokaryotic expression systems such as E. coli, as evidenced by the commercially available His-tagged recombinant protein . For expression and purification:

  • Clone the full-length bovine TMEM68 cDNA (encoding amino acids 1-334) into an appropriate expression vector containing an N-terminal His-tag.

  • Transform the construct into E. coli expression strains (typically BL21(DE3) or similar).

  • Induce protein expression using IPTG under optimized conditions.

  • Lyse cells and purify using nickel affinity chromatography.

  • Perform additional purification steps if needed (ion exchange, size exclusion).

  • Lyophilize the purified protein in appropriate buffer (typically Tris/PBS-based buffer, pH 8.0 with 6% trehalose) .

For reconstitution, the lyophilized protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and 5-50% glycerol should be added for long-term storage at -20°C/-80°C .

What experimental approaches can be used to study TMEM68's enzymatic activity?

To investigate TMEM68's enzymatic activities as an acyltransferase, researchers can employ these methodological approaches:

  • In vitro enzymatic assays: Using purified recombinant TMEM68, researchers can measure both MGAT and DGAT activities by monitoring the conversion of radioactively labeled substrates (such as 14C-labeled monoacylglycerol or diacylglycerol) to the respective products .

  • Cellular overexpression systems: Transfect cells (such as COS-7 or HEK293) with TMEM68 expression constructs and measure changes in cellular lipid profiles using lipidomic approaches .

  • Site-directed mutagenesis: Create point mutations in the conserved active sites to validate their importance for enzymatic function .

  • Quantitative targeted lipidomics: Analyze changes in cellular lipid profiles, including diacylglycerol (DG), free fatty acids (FFA), triacylglycerol (TG), and various glycerophospholipids to comprehensively assess TMEM68's impact on lipid metabolism .

  • Gene expression analysis: Examine changes in lipogenic gene expression patterns upon TMEM68 overexpression or knockdown using qRT-PCR or RNA-seq approaches .

How can the subcellular localization of TMEM68 be determined?

To determine the subcellular localization of TMEM68, researchers can use:

  • Confocal fluorescence microscopy: Express fluorescent protein-tagged TMEM68 (e.g., TMEM68-GFP) in mammalian cells alongside organelle markers (e.g., DsRed-ER for endoplasmic reticulum) and observe co-localization patterns .

  • Subcellular fractionation: Separate cellular components by differential centrifugation and detect TMEM68 in different fractions using immunoblotting .

  • Protease protection assays: To determine membrane topology, treat membrane vesicles containing tagged TMEM68 (e.g., His6-TMEM68 or TMEM68-FLAG) with proteinase K in the presence or absence of detergents and analyze by immunoblotting .

  • Deletion mutant analysis: Generate mutants lacking specific transmembrane domains (e.g., ΔTMD1, ΔTMD2) and assess their localization to determine which domains are essential for proper targeting .

How does TMEM68 differ from canonical DGAT enzymes in triacylglycerol synthesis?

TMEM68 represents an alternative pathway for triacylglycerol synthesis that operates independently of the canonical DGAT1 and DGAT2 enzymes . Key differences include:

What effects does TMEM68 overexpression have on cellular lipid profiles?

Overexpression of TMEM68 leads to significant alterations in cellular lipid profiles, as demonstrated through lipidomic analyses:

  • Increased storage lipids: Elevated levels of triacylglycerol (TG), diacylglycerol (DG), and free fatty acids (FFA) .

  • Altered membrane lipids: Changes in several glycerophospholipids, including phosphatidylcholine (PC), phosphatidylethanolamine (PE), and phosphatidylinositol (PI) .

  • Impact on sterol esters: Modified sterol ester content, suggesting broader effects on lipid metabolism beyond glycerolipids .

  • Reduced ether-linked glycerophospholipids: Profound reduction in ether-linked GPLs, indicating a shift from membrane to storage lipids .

  • Altered fatty acid composition: Diminished prevalence of polyunsaturated glycerophospholipids, suggesting effects on fatty acid selectivity or metabolism .

What is the relationship between TMEM68 and lipid droplet formation?

TMEM68 plays a significant role in lipid droplet (LD) formation through its function in triacylglycerol synthesis:

  • Overexpression of TMEM68 promotes lipid droplet formation in mammalian cells, dependent on its conserved active sites .

  • TMEM68 itself is not localized to lipid droplets but remains in the endoplasmic reticulum, where it contributes to the initial steps of lipid droplet biogenesis .

  • The mechanism involves increased triacylglycerol synthesis, which accumulates between the leaflets of the ER membrane, eventually budding off to form nascent lipid droplets .

  • By affecting the expression of lipogenic genes, including DGATs, fatty acid synthesis-related genes, and peroxisome proliferator-activated receptor γ (PPARγ), TMEM68 may indirectly enhance the cellular capacity for lipid droplet formation .

What is known about TMEM68 expression in brain tissue?

TMEM68 shows particularly high expression in brain tissue compared to other tissues . This tissue-specific expression pattern suggests specialized roles in brain lipid metabolism:

  • TMEM68 may contribute to the unique lipid composition of the brain, which is rich in specialized glycerophospholipids and has distinct fatty acid profiles compared to other tissues .

  • As a triacylglycerol synthase highly expressed in the brain, TMEM68 likely plays a role in neuronal energy storage and utilization .

  • The alternative pathway for TAG synthesis mediated by TMEM68 may be particularly important in neural tissues during development or under specific metabolic conditions .

  • Recent research has begun investigating TMEM68 function in neuro- and gliablastoma cells, suggesting potential roles in brain cancer metabolism that differ from its functions in normal neural tissue .

How does TMEM68 function in different cell types?

TMEM68 appears to have context-dependent functions across different cell types:

  • Neural cells: In neuroblastoma cells, TMEM68 contributes to TAG synthesis independently of canonical DGAT enzymes and affects the composition of membrane lipids, particularly ether-linked glycerophospholipids .

  • Glial cells: Similar to neural cells, gliablastoma cells utilize TMEM68 for TAG synthesis, though potentially with different regulatory mechanisms or metabolic consequences .

  • Hepatic cells: While less studied than neural contexts, TMEM68 likely contributes to liver lipid metabolism given its acyltransferase activity .

  • Expression patterns: The varied expression levels of TMEM68 across tissues suggest cell type-specific functions, with highest expression in brain and lower but significant expression in other metabolically active tissues .

How can researchers investigate TMEM68's role during lipid starvation?

To study TMEM68's function during lipid starvation conditions:

  • Cellular models: Culture cells expressing TMEM68 (endogenous or recombinant) in lipid-depleted media and assess:

    • Changes in TMEM68 expression and localization

    • Alterations in mitochondrial function (membrane potential, respiration, ATP production)

    • Modifications to cellular lipid profiles using lipidomics approaches

  • Genetic manipulation: Use CRISPR/Cas9 to generate TMEM68 knockout cells and compare their response to lipid starvation against wild-type cells, specifically examining:

    • Cell viability and stress markers

    • Mitochondrial morphology and function

    • Compensatory lipid metabolic pathways

  • Metabolic flux analysis: Employ isotope-labeled substrates to track carbon flow through lipid metabolic pathways during starvation in the presence or absence of TMEM68 .

What experimental approaches can resolve contradicting data regarding TMEM68 function?

When researchers encounter contradicting data regarding TMEM68 function, these methodological approaches can help resolve discrepancies:

  • Cell-type specificity: Test TMEM68 function across multiple cell types representing different tissues to determine if contradictions arise from cell-specific contexts .

  • Conditional expression systems: Use inducible expression systems to control TMEM68 levels precisely and assess dose-dependent effects that might explain seemingly contradictory results .

  • Complementary techniques: Combine genetic (overexpression, knockdown, knockout), biochemical (in vitro enzyme assays), and analytical (lipidomics) approaches to build a comprehensive understanding of TMEM68 function .

  • Substrate specificity profiling: Systematically test TMEM68 activity with diverse lipid substrates under varied conditions to fully characterize its enzymatic capabilities and preferences .

  • Structure-function analysis: Generate and test point mutations throughout the protein to identify critical residues for different activities that might be differentially affected under various experimental conditions .

What quality control measures should be applied to recombinant bovine TMEM68?

For ensuring the quality of recombinant bovine TMEM68 preparations:

  • Purity assessment: Analyze by SDS-PAGE to confirm purity greater than 90% .

  • Protein folding verification: Use circular dichroism (CD) spectroscopy to evaluate secondary structure elements expected for a transmembrane protein.

  • Activity validation: Perform in vitro acyltransferase assays to confirm MGAT and DGAT activities are preserved in the recombinant protein .

  • Thermal stability testing: Use differential scanning fluorimetry to assess protein stability under various buffer conditions.

  • Storage stability monitoring: Test activity retention after multiple freeze-thaw cycles and extended storage periods (note that repeated freezing and thawing is not recommended for TMEM68) .

What are the optimal conditions for handling recombinant bovine TMEM68?

Based on available data, researchers should follow these guidelines for optimal handling of recombinant bovine TMEM68:

ParameterRecommended ConditionNotes
Storage temperature-20°C to -80°CAliquoting is necessary for multiple use
Storage bufferTris/PBS-based, pH 8.0, with 6% TrehaloseProvides stability during storage
Reconstitution mediumDeionized sterile waterTo concentration of 0.1-1.0 mg/mL
Long-term preservationAdd 5-50% glycerol (final concentration)50% is commonly used
Working conditionsStore working aliquots at 4°CUse within one week
Freeze-thaw cyclesMinimizeRepeated cycles not recommended

Following these conditions will help maintain protein stability and enzymatic activity for experimental applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.