Recombinant Bovine Transmembrane protein 80 (TMEM80)

What is Bovine TMEM80 and what is known about its structure?

Bovine Transmembrane protein 80 (TMEM80) is a 143-amino acid protein encoded by the TMEM80 gene. The full-length protein has the amino acid sequence: MAAPRRGKASSTVLSSLPLQMLLCLSGTYYALYFLATLLLLVYKSQVFTYPHSCLVLDLTLLFLMGILEAIRLYFGTTGNLMEAEVPLAASLVLTVGSALLSAYFLLWQTLVLRADSALGAPLLALHGLEAVLQVVAIAAFVS . As its name indicates, TMEM80 is a transmembrane protein, which presents particular challenges for expression, purification, and structural studies. The protein is part of the larger transmembrane protein family that plays crucial roles in various cellular processes. While detailed three-dimensional structural information is still limited, the primary sequence analysis suggests multiple transmembrane domains characteristic of integral membrane proteins.

How does Bovine TMEM80 compare to human and mouse orthologs?

Bovine TMEM80 consists of 143 amino acids, while the human ortholog is 168 amino acids in length and the mouse version is 123 amino acids . This variation in length suggests potential functional or regulatory differences across species. Sequence alignment studies would be necessary to identify conserved domains and species-specific regions. When designing experiments involving TMEM80 across different species, researchers should consider these differences, especially when developing antibodies or when conducting cross-species functional studies. The availability of recombinant versions from different species (human, mouse, and bovine) allows for comparative studies to understand the evolutionary conservation and divergence of TMEM80 function .

What expression systems are optimal for producing recombinant Bovine TMEM80?

• E. coli expression: Suitable for high yield but may require extensive optimization for proper folding of transmembrane domains .

• Mammalian cell expression: HEK293T cells can be used for small-scale transient expression to test construct viability .

• BacMam system: Using HEK293S GnTi- cells transduced with baculovirus provides a scalable approach for larger quantities needed for structural studies .

The choice depends on research goals - E. coli systems may be sufficient for antibody production or interaction studies, while mammalian systems are preferable for functional or structural analyses requiring proper folding and modifications.

What are the methodological considerations for optimizing TMEM80 expression in mammalian systems?

For optimal expression of TMEM80 in mammalian systems, researchers should consider the following methodological approach:

• Plasmid design: Incorporation of fusion tags (like mVenus) can help monitor expression and folding .

• Transfection protocol:

  • Use 2 μg purified DNA with 6 μg PEI (1 mg/ml) in 200 μl total DMEM media

  • Allow complex formation for 15-20 minutes at room temperature

  • Add to cells and incubate for 48 hours at 37°C

• Cell harvesting:

  • Rinse cells with PBS and dislodge by pipetting or using a cell scraper

  • Centrifuge at 3000 ×g for 10 minutes

• Protein solubilization:

  • Resuspend cell pellet in solubilization buffer

  • Add appropriate detergent (e.g., 10% DDM or 20% DM ± CHS and lipid)

  • Rotate at 4°C for 1.5 hours

Small-scale expression tests should precede large-scale production to verify proper expression and folding of the recombinant protein.

What purification strategies are most effective for recombinant Bovine TMEM80?

Purification of recombinant Bovine TMEM80 requires strategies optimized for transmembrane proteins. The following approach is recommended based on protocols for similar proteins:

• Cell lysis and solubilization:

  • Use appropriate detergents to solubilize the membrane fraction

  • Centrifuge at 21,000 ×g at 4°C to remove cell debris

• Affinity chromatography:

  • For His-tagged TMEM80, use immobilized metal affinity chromatography (IMAC)

  • Consider using spin filters for initial capture steps in small-scale purifications

• Size exclusion chromatography:

  • Further purify the protein to remove aggregates and ensure homogeneity

  • Analyze fractions using SDS-PAGE and fluorescence-detection size exclusion chromatography (FSEC) if using fluorescent fusion tags

The purity of recombinant Bovine TMEM80 should be greater than 90% as determined by SDS-PAGE analysis to ensure reliable experimental outcomes .

How can researchers assess the proper folding and stability of purified TMEM80?

Assessing proper folding and stability of purified TMEM80 is crucial for downstream applications. Recommended methods include:

• SDS-PAGE analysis:

  • Examine under both reducing and non-reducing conditions to assess potential oligomerization

  • Compare migration patterns to theoretical molecular weight (approximately 16-17 kDa plus tag contribution)

• Fluorescence-detection size exclusion chromatography (FSEC):

  • Particularly useful if using fluorescent fusion tags like mVenus

  • Provides information about protein homogeneity and oligomeric state

• Thermal stability assays:

  • Differential scanning fluorimetry (DSF) to assess protein stability

  • Test stability in different buffer conditions and detergents

• Functional assays:

  • Develop binding or activity assays based on predicted functions

  • Compare with positive controls when possible

These characterization methods should be employed systematically to ensure that the recombinant protein maintains its native conformation and stability before proceeding to functional studies.

What are the optimal storage conditions for maintaining TMEM80 stability?

Recombinant Bovine TMEM80 requires specific storage conditions to maintain stability and functionality. Based on available data, the following protocols are recommended:

• Long-term storage:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

• Buffer composition:

  • Use Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Consider including glycerol (recommended final concentration 50%) for frozen storage

• Reconstitution protocol:

  • Briefly centrifuge vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For working aliquots, store at 4°C for up to one week

Stability studies indicate that repeated freeze-thaw cycles significantly reduce protein activity, making proper aliquoting essential for maintaining TMEM80 functionality over time.

What experimental approaches are recommended for investigating TMEM80 function?

Although specific functions of Bovine TMEM80 are still being elucidated, several experimental approaches can be employed:

• Protein-protein interaction studies:

  • Use pull-down assays with His-tagged TMEM80 as bait

  • Consider proximity labeling approaches such as BioID or APEX

  • Employ co-immunoprecipitation with antibodies against TMEM80 or interaction partners

• Cellular localization studies:

  • Use fluorescently tagged TMEM80 constructs for live cell imaging

  • Perform immunofluorescence with anti-TMEM80 antibodies

  • Conduct subcellular fractionation followed by Western blotting

• Loss-of-function studies:

  • Design siRNA or CRISPR-Cas9 strategies targeting TMEM80

  • Analyze resulting phenotypes for clues to protein function

  • Compare phenotypes across different cell types relevant to bovine physiology

• Structure-function relationship studies:

  • Generate truncated versions or domain-specific mutants

  • Assess impact on localization, stability, and interaction profile

These approaches should be utilized in combination to develop a comprehensive understanding of TMEM80's biological role.

How can TMEM80 be integrated into broader studies of membrane protein biology?

TMEM80 research can contribute to the broader field of membrane protein biology through several strategic approaches:

• Comparative studies with other transmembrane proteins:

  • Analyze expression patterns alongside other TMEM family members

  • Compare structural features with well-characterized membrane proteins

  • Examine conservation patterns across different species and TMEM family members

• Method development:

  • Use TMEM80 as a model system for optimizing membrane protein production protocols

  • Develop improved solubilization and stabilization strategies

  • Test novel crystallization or cryo-EM approaches for structural determination

• Systems biology integration:

  • Incorporate TMEM80 data into larger protein interaction networks

  • Analyze co-expression patterns with other membrane proteins

  • Investigate potential roles in known signaling pathways or cellular processes

These integrative approaches can position TMEM80 research within the context of membrane protein biology more broadly, potentially revealing unexpected connections and functions.

What are common challenges in working with recombinant TMEM80 and how can they be addressed?

Working with transmembrane proteins like TMEM80 presents several technical challenges:

• Low expression yields:

  • Optimize codon usage for the expression system

  • Test different promoters and expression conditions

  • Consider fusion partners that enhance expression (e.g., SUMO, MBP)

  • Implement the BacMam system for enhanced expression in mammalian cells

• Protein aggregation:

  • Screen multiple detergents for optimal solubilization

  • Add stabilizing agents such as cholesterol hemisuccinate (CHS)

  • Consider nanodiscs or other membrane mimetics for improved stability

  • Test expression at lower temperatures to improve folding

• Purification difficulties:

  • Optimize detergent concentration in all purification buffers

  • Include glycerol or other stabilizing agents

  • Minimize exposure to air and maintain consistent cold temperature

  • Consider on-column detergent exchange during purification

• Functional assay development:

  • Design experiments based on predicted functions from bioinformatic analysis

  • Develop robust positive and negative controls

  • Consider reconstitution into proteoliposomes for functional studies

Systematic optimization of these parameters can significantly improve the quality and yield of recombinant TMEM80 for research applications.

How can researchers distinguish between properly folded and misfolded recombinant TMEM80?

Distinguishing between properly folded and misfolded TMEM80 is critical for experimental validity:

• Biophysical approaches:

  • Circular dichroism (CD) spectroscopy to assess secondary structure content

  • Thermal stability assays to measure unfolding transitions

  • Size exclusion chromatography profiles (symmetric vs. asymmetric peaks)

• Biochemical indicators:

  • SDS-PAGE migration patterns under non-reducing vs. reducing conditions

  • Protease resistance assays (properly folded proteins often show distinct proteolysis patterns)

  • Detergent exchange tolerance (stable, well-folded proteins can withstand detergent exchange)

• Functional indicators:

  • Binding to known interaction partners

  • Proper subcellular localization when expressed in mammalian cells

  • Epitope accessibility in antibody-based assays

Implementing these quality control measures ensures that subsequent experiments utilize properly folded protein, enhancing reproducibility and reliability of research findings.