Recombinant Bovine Transmembrane protein 88B (TMEM88B)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine Transmembrane Protein 88B (TMEM88B)

Recombinant bovine TMEM88B is a synthetic form of the transmembrane protein encoded by the TMEM88B gene. It is produced through recombinant DNA technology, where the gene is expressed in heterologous systems such as E. coli, yeast, baculovirus, or mammalian cells . This protein is integral to cellular signaling pathways and has potential applications in biomedical research and therapeutic development.

Production and Characteristics

Recombinant bovine TMEM88B is manufactured with varying host systems and purification protocols:

ParameterDetails
Host SystemsE. coli, yeast, baculovirus, mammalian cells, or cell-free expression
Purity≥85% as determined by SDS-PAGE
TagsHis-tag for purification and immobilization
Protein LengthFull-length (e.g., 166 amino acids in bovine)

Key Features:

  • Cell-Free Expression: Enables rapid production without cellular contamination .

  • His-Tagged Proteins: Facilitate affinity chromatography-based purification .

  • Full-Length Sequences: Preserve functional domains critical for interactions (e.g., PDZ-binding motifs) .

Primary Pathways

PathwayRole
Wnt/β-Catenin SignalingInhibits canonical Wnt signaling via interactions with Dishevelled (DVL) proteins, regulating cell proliferation and differentiation .
Cardiomyocyte DevelopmentSuppression of Wnt signaling specifies cardiovascular progenitor cells in embryogenesis .
Cancer PathogenesisDivergent roles: cytoplasmic TMEM88 may promote tumor progression, while nuclear TMEM88 may suppress metastasis .

Mechanistic Insights:

  • Wnt Modulation: TMEM88B binds DVL proteins, blocking β-catenin nuclear translocation and downstream oncogene expression (e.g., c-Myc, Cyclin D1) .

  • Subcellular Localization: Cytoplasmic vs. nuclear TMEM88B may dictate opposing effects on cell migration and drug resistance .

Applications in Research

Recombinant bovine TMEM88B serves as a tool for studying:

  1. Signal Transduction: Investigating Wnt pathway dynamics in cattle diseases (e.g., fibrosis, inflammation).

  2. Therapeutic Targeting: Exploring TMEM88B as a biomarker or drug target in veterinary oncology.

  3. Structural Biology: Elucidating PDZ-binding interactions critical for protein-protein networks .

Research Gaps and Future Directions

  • Bovine-Specific Studies: Limited data exist on TMEM88B’s role in cattle physiology or disease.

  • Therapeutic Potential: Preclinical models are needed to validate TMEM88B’s utility in modulating Wnt signaling for cancer or regenerative therapies .

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM88B; Transmembrane protein 88B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM88B
Target Protein Sequence
MSDQERETEEDEGGDPSDTAPMLPQRLPDHQASDLMSPGWASLAARGLGTLLFQGWALAR LLLHLLLPAAVFLLVLLPAAAVVYLGFLCHSRVHPAPRPACRALLSDRGSAAVIVLGFLS LPPLLVLASAARARLARRLHSLLPPPTWSPGPHRQSDGEKQLCAWV
Uniprot No.

Target Background

Database Links

KEGG: bta:767837

UniGene: Bt.56661

Protein Families
TMEM88 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is bovine TMEM88B and how does it relate to the TMEM88 family?

Bovine TMEM88B is a transmembrane protein belonging to the TMEM88 family. Based on available sequence data, bovine TMEM88B contains 166 amino acids and is predicted to be a membrane-spanning protein . While TMEM88 has been characterized as a two-transmembrane-type protein with a C-terminal PDZ-binding motif that interacts with Dishevelled (Dvl) proteins, TMEM88B appears to be a paralog with similar structural characteristics . The full-length bovine TMEM88B protein sequence includes specific domains that suggest membrane localization, although detailed structural analyses remain limited compared to the more extensively studied TMEM88 .

How is bovine TMEM88B's gene organized and what are its key domains?

The bovine TMEM88B gene encodes a 166-amino acid protein with predicted transmembrane regions . Based on homology with TMEM88, which has been more thoroughly characterized, TMEM88B likely contains:

  • N-terminal cytoplasmic domain

  • Two transmembrane spanning regions

  • A potential C-terminal functional domain

The sequence information available for bovine TMEM88B (Bos taurus) indicates the coding sequence is 501 base pairs in length . Comparison with TMEM88 suggests the presence of conserved motifs that may be involved in protein-protein interactions, particularly at the C-terminus, though specific analysis of bovine TMEM88B domains is not extensively documented in current literature .

What is the role of TMEM88B in Wnt/β-catenin signaling pathways?

While specific research on bovine TMEM88B's role in Wnt signaling is limited, studies on TMEM88 provide insight into the likely function of TMEM88B. TMEM88 has been shown to attenuate Wnt/β-catenin signaling induced by Wnt-1 ligand in a dose-dependent manner . This inhibitory effect occurs through interaction with Dishevelled (Dvl) proteins via the PDZ domain .

In experimental models, TMEM88 overexpression resulted in significant reduction of Wnt-1-induced luciferase activity, while knockdown of TMEM88 via RNAi increased Wnt activity . Given the structural similarities, TMEM88B may serve a comparable function in regulating Wnt signaling pathways, potentially with tissue-specific effects that differ from TMEM88 .

How does TMEM88B potentially influence cellular differentiation processes?

Based on research with TMEM88, which has been shown to play a crucial role in cardiac development, TMEM88B may have similar developmental functions . TMEM88 is highly upregulated prior to expression of cardiac transcription factors such as Nkx2.5 and Isl1, suggesting its important role in early cardiac differentiation .

Studies demonstrated that TMEM88 knockdown inhibits cardiomyocyte differentiation while promoting endothelial differentiation, indicating its involvement in cell fate decisions . TMEM88 acts downstream of GATA factors in pre-cardiac mesoderm to specify lineage commitment through inhibition of Wnt/β-catenin signaling . Given the homology between these proteins, TMEM88B might participate in similar or complementary cellular differentiation processes, possibly in different tissues or developmental stages, though direct evidence for bovine TMEM88B's role remains to be established .

What expression systems are most effective for producing recombinant bovine TMEM88B?

Multiple expression systems have been utilized for TMEM88B production, with varying advantages:

Expression SystemAdvantagesApplicationsTag Options
E. coliHigh yield, cost-effective, simpler protocolStructural studies, antibody productionHis-tag is common
HEK293 cellsBetter post-translational modifications, proper foldingFunctional assays, protein-protein interaction studiesHis, Avi, Fc tags available
Mammalian cellsNative-like glycosylation, optimal for full-length proteinComplex functional studiesVarious tags possible

For recombinant bovine TMEM88B specifically, E. coli-based expression systems using His-tagging have been documented for full-length protein production . The selection of an appropriate expression system should be guided by the intended experimental application and required protein characteristics.

What are the recommended purification strategies for recombinant bovine TMEM88B?

Purification of recombinant bovine TMEM88B typically follows a multi-step process:

  • Affinity chromatography: For His-tagged bovine TMEM88B, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is the primary purification step .

  • Size exclusion chromatography: Often used as a second purification step to remove aggregates and obtain homogeneous protein preparations.

  • Tag removal considerations: If the experimental design requires tag removal, appropriate protease cleavage sites (such as thrombin or TEV) should be incorporated into the construct design.

When expressing TMEM88 family proteins as GST fusions, glutathione-Sepharose 4B beads have been successfully used for affinity purification with elution by free glutathione . Similar approaches may be applicable to bovine TMEM88B.

How conserved is TMEM88B across species and what insights does this provide?

TMEM88B shows evolutionary conservation across vertebrate species, though with some variations in sequence length and specific domains:

This conservation suggests important functional roles for TMEM88B. In comparison, TMEM88 has been identified only in vertebrate chordates based on phylogenetic analysis , suggesting that the TMEM88 family, including TMEM88B, may have evolved relatively recently in evolutionary terms, potentially coinciding with the development of complex cardiac and other tissue-specific developmental programs .

How can recombinant bovine TMEM88B be used in developmental biology studies?

Recombinant bovine TMEM88B can serve several functions in developmental biology research:

  • Signaling pathway investigation: As a potential regulator of Wnt signaling similar to TMEM88, recombinant TMEM88B can be used in reporter assays to study its effects on Wnt/β-catenin pathway activity in various cell types .

  • Protein-protein interaction studies: Purified TMEM88B can be employed in pull-down assays, co-immunoprecipitation, or surface plasmon resonance to identify binding partners and characterize interaction domains .

  • Cell differentiation models: Given TMEM88's role in cardiac development, recombinant TMEM88B can be tested in stem cell differentiation protocols to assess its effects on lineage specification .

  • Comparative studies: Using both recombinant TMEM88 and TMEM88B in parallel experiments can help elucidate their distinct and overlapping functions in development .

For optimal results, experimental designs should consider the membrane-associated nature of the protein and incorporate appropriate controls when studying its effects on cellular processes .

What methodological considerations are important when designing experiments with recombinant bovine TMEM88B?

When designing experiments with recombinant bovine TMEM88B, researchers should consider:

  • Protein solubility and storage: As a transmembrane protein, TMEM88B may have solubility limitations. Consider using appropriate detergents or lipid environments for functional studies. Storage recommendations typically include 50% glycerol in Tris-based buffer at -20°C for extended storage .

  • Functional domain preservation: Ensure that expression constructs maintain critical functional domains, particularly if the C-terminal region contains a PDZ-binding motif similar to TMEM88 . Truncated constructs may have altered activity.

  • Tag interference: Consider whether N- or C-terminal tags might interfere with protein function, especially if the C-terminus is involved in protein-protein interactions as with TMEM88 .

  • Appropriate controls: Include both negative controls (e.g., GST alone if using GST-fusion proteins) and positive controls (e.g., known Wnt pathway modulators) in functional assays .

  • Cell type considerations: The effects of TMEM88 family proteins may be cell-type specific, so selection of appropriate cellular models is crucial .

  • Validation strategies: Employ multiple methods to confirm interactions and effects, such as combining biochemical assays with cellular studies and potentially in vivo models where feasible .

How might TMEM88B function differ from TMEM88 in regulating developmental processes?

This represents an important frontier in TMEM88B research. While TMEM88 has been established as a critical regulator of cardiac development through Wnt signaling inhibition , TMEM88B's specific developmental roles remain largely unexplored. Future investigations could:

  • Perform comparative expression profiling of TMEM88 and TMEM88B across tissues and developmental stages

  • Conduct parallel knockdown/knockout studies to identify distinct phenotypes

  • Determine tissue-specific binding partners that might direct different functions

  • Analyze potential compensatory mechanisms between these family members

Differences in expression patterns, interaction partners, and regulatory mechanisms could reveal specialized functions for TMEM88B in developmental processes distinct from cardiac development, or in fine-tuning Wnt signaling in specific cellular contexts .

What are the technical challenges in studying transmembrane proteins like bovine TMEM88B and how can they be overcome?

Studying transmembrane proteins presents several technical challenges:

  • Protein solubility and aggregation: Transmembrane proteins often aggregate during purification due to their hydrophobic domains. This can be addressed through:

    • Optimization of detergent types and concentrations

    • Use of amphipols or nanodiscs to maintain native-like membrane environments

    • Development of truncated constructs that maintain key functional domains while improving solubility

  • Structural determination: Traditional structural biology approaches are challenging with membrane proteins. Consider:

    • Cryo-electron microscopy as an alternative to X-ray crystallography

    • NMR studies of specific domains

    • Computational modeling based on homologous proteins

  • Functional reconstitution: For activity assays, proteins may need to be reconstituted in artificial membrane systems to maintain native function.

  • Interaction studies: Membrane context can significantly affect protein-protein interactions. Approaches like:

    • Membrane yeast two-hybrid systems

    • FRET-based interaction studies in cells

    • Surface plasmon resonance with membrane mimetics

Can provide more physiologically relevant results than traditional interaction assays .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.