Recombinant Bovine Transmembrane protein 88 (TMEM88)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If a specific tag is required, please inform us, and we will prioritize its implementation.
Synonyms
TMEM88; Transmembrane protein 88
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM88
Target Protein Sequence
MADVPGAQRPVPGGGPEPRDPLDCWACAVLVTAQNLLVAAFNLLLLALVLGTILLPAVTM LGFGFLCHSQFLRSQAPPCTAHLRDPGFTALLVTGFLLLVPLLVLALASYRRLCLRLRLA DCLVPYSRALYRRRRNPQPRPARSSPGPQVAPTSGKVWV
Uniprot No.

Target Background

Function

Recombinant Bovine Transmembrane protein 88 (TMEM88) inhibits the Wnt/β-catenin signaling pathway. It plays a critical role in heart development, functioning downstream of GATA factors in the pre-cardiac mesoderm to specify cardiomyocyte lineage commitment.

Database Links
Protein Families
TMEM88 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is TMEM88 and what are its key structural features?

Transmembrane protein 88 (TMEM88) is a double-transmembrane protein first identified in 2010 as a dishevelled-binding protein that regulates Wnt/β-catenin signaling. Structurally, TMEM88 contains two transmembrane domains and a critical C-terminal PDZ-binding motif composed of the tripeptide VWV (Val-Trp-Val). This motif is essential for its interaction with the PDZ domain of Dishevelled (Dvl), which mediates its role in Wnt signaling regulation .

The TMEM88 gene produces multiple isoforms, with TMEM88 CRA_a (containing the PDZ binding motif) being the dominant isoform expressed during human embryonic stem cell cardiac differentiation. When investigating TMEM88 expression and function, researchers should consider which isoform they are studying, as functional differences between isoforms may exist .

How does TMEM88 function in the Wnt/β-catenin signaling pathway?

TMEM88 primarily functions as a negative regulator of the Wnt/β-catenin signaling pathway through multiple mechanisms:

  • Direct interaction with Dishevelled (Dvl) through its C-terminal PDZ-binding motif, which can disrupt the Dvl-Frizzled (Fz) interaction required for Wnt signal transduction

  • Inhibition of Wnt signaling at a level downstream of the β-catenin destruction complex, suggesting multiple points of regulation within this pathway

  • Promotion of Wnt signalosome formation in multivesicular bodies (MVBs), which may contribute to signal regulation

Experimental evidence shows that overexpression of TMEM88 attenuates Wnt-1-induced activation of luciferase reporters in a dose-dependent manner, while deletion of the PDZ-binding motif (TMEM88ΔC4) abolishes this inhibitory effect. Furthermore, knockdown of TMEM88 by RNAi enhances Wnt signaling activity, confirming its role as a suppressor of this pathway .

What expression patterns does TMEM88 exhibit during development?

TMEM88 displays highly regulated spatiotemporal expression patterns during embryonic development:

  • In human embryonic stem cell (hESC) cardiac differentiation, TMEM88 is activated shortly after the mesoderm marker brachyury (T) and increases during the specification of cardiovascular progenitor cells, preceding the expression of cardiac transcription factors like NKX2.5 and TBX5

  • In zebrafish embryos, TMEM88 is expressed in the ventro-lateral mesoderm, which includes the bilateral heart fields, overlapping with the expression of cardiac transcription factors like Nkx2.5 and MEF2c

  • Chromatin dynamics studies show TMEM88 is marked by repressive H3K27 trimethylation in the undifferentiated state and during mesoderm lineage specification, which then shifts to activating H3K4me3 marks as cell fate becomes restricted to cardiovascular progenitors

When studying developmental expression patterns, researchers should employ multiple complementary techniques such as qPCR, in situ hybridization, and chromatin immunoprecipitation to fully characterize the dynamics of TMEM88 expression.

How does TMEM88 regulate cardiomyocyte specification during development?

TMEM88 plays a critical role in cardiac development through its regulation of Wnt/β-catenin signaling, which exhibits a biphasic pattern during cardiogenesis. Experimental evidence demonstrates that:

  • Wnt/β-catenin signaling must be initially activated for mesoderm development but subsequently suppressed for specification of cardiogenic mesoderm, with TMEM88 acting as a key mediator of this suppression phase

  • Knockdown of TMEM88 via short hairpin RNA in human embryonic stem cells results in failure to specify the cardiac lineage, as evidenced by significantly reduced expression of Nkx2.5, Tbx5, and cardiac troponin T (cTnT)

  • Linear regression analysis reveals a dose-dependent relationship between TMEM88 expression and cTnT levels, suggesting quantitative regulation of cardiomyocyte differentiation

  • Morpholino knockdown of TMEM88 in zebrafish significantly disrupts heart development, with some embryos completely failing to generate a heart

These findings indicate that TMEM88 acts as a molecular switch that helps direct the fate of cardiac progenitor cells by inhibiting Wnt signaling at the appropriate developmental time point. Researchers studying cardiac development should consider TMEM88 as an essential regulator that promotes cardiomyocyte differentiation while suppressing alternative fates such as endothelial differentiation .

What is the significance of TMEM88's subcellular localization for its function?

TMEM88's subcellular localization is critical for its function and is regulated by several factors:

  • TMEM88 requires its PDZ-binding motif for trafficking from the Golgi apparatus to the plasma membrane, where it can interact with Dishevelled and other signaling components

  • In Xenopus studies, TMEM88 localizes to the cell membrane and can recruit Dishevelled to this location, potentially sequestering it from downstream signaling components

  • TMEM88 has been found in multivesicular bodies (MVBs) associated with endocytosed Wnt signalosomes, suggesting a role in regulating Wnt signaling through control of endocytic trafficking

  • Interestingly, in breast cancer studies, TMEM88 function appears to depend on its subcellular localization, with cytoplasmic TMEM88 potentially promoting tumor progression while nuclear TMEM88 may suppress tumors

These findings highlight the importance of carefully analyzing TMEM88's subcellular distribution when investigating its functional roles. Researchers should employ high-resolution imaging techniques such as confocal microscopy with appropriate cellular compartment markers to accurately determine TMEM88's localization in their experimental systems.

What are the conflicting roles of TMEM88 in different cancer types and how can these be reconciled?

TMEM88 exhibits context-dependent roles across different cancer types, presenting a complex picture of its function in tumor biology:

In hepatocellular carcinoma (HCC):

In ovarian cancer:

  • TMEM88 is significantly increased in platinum-resistant ovarian cancer and recurrent ovarian cancer tissue

  • Knockdown of TMEM88 can resensitize tumor cells to platinum drugs

  • TMEM88 overexpression may induce cell dormancy that helps cells evade chemotherapy effects

In thyroid cancer:

  • TMEM88 overexpression reduces TCF/LEF transcriptional activity and inhibits expression of downstream Wnt/β-catenin target genes c-Myc and cyclin D1

  • This inhibition suppresses thyroid cancer cell proliferation and invasion

These disparate findings might be reconciled by considering:

  • Tissue-specific contexts and interactions with different signaling networks

  • Variations in subcellular localization of TMEM88 (as observed in breast cancer where cytoplasmic vs. nuclear localization correlated with opposite outcomes)

  • Differential expression of TMEM88 isoforms across tumor types

  • Stage-specific roles during cancer progression

Researchers investigating TMEM88 in cancer should carefully control for these variables and consider employing tissue-specific knockout or transgenic models to elucidate context-dependent functions.

What are the recommended approaches for studying TMEM88 protein-protein interactions?

Several complementary methods have proven effective for studying TMEM88 interactions with other proteins:

  • Nuclear Magnetic Resonance (NMR) spectroscopy:

    • Has been successfully used to demonstrate binding between the PDZ domain of Dvl-1 and the C-terminal tail of TMEM88

    • Allows detection of chemical shift perturbations when the C-terminus of TMEM88 occupies the binding groove of the Dvl-1 PDZ domain

  • Fluorescence spectroscopy:

    • Provides quantitative binding affinity measurements between TMEM88 and its interaction partners

    • Has shown that the binding affinity of TMEM88C to the Dvl-1 PDZ domain is similar to other known Dvl PDZ-binding partners

  • Co-immunoprecipitation (Co-IP):

    • Effective for confirming interactions in cellular contexts

    • Should include appropriate controls such as TMEM88 constructs lacking the PDZ-binding motif

  • Proximity ligation assays:

    • Can detect protein interactions in situ with high sensitivity

    • Particularly useful for visualizing interactions in specific subcellular compartments

  • Yeast two-hybrid screening:

    • Valuable for identifying novel interaction partners beyond the known Dvl interaction

When designing these experiments, researchers should consider using both wild-type TMEM88 and mutant variants (particularly those lacking the PDZ-binding motif) to confirm specificity of interactions and identify functional domains required for specific protein-protein interactions.

What are the optimal methods for manipulating TMEM88 expression in experimental systems?

Based on successful approaches documented in the literature, researchers should consider the following methods for modulating TMEM88 expression:

For knockdown studies:

  • RNA interference (RNAi):

    • Short hairpin RNA (shRNA) targeting TMEM88 has been effective in human embryonic stem cell systems

    • siRNA approaches have been successful in cancer cell lines and can achieve significant knockdown

    • When designing RNAi, researchers should target sequences conserved across relevant TMEM88 isoforms

  • Morpholino oligonucleotides:

    • Effective for in vivo studies in zebrafish embryos

    • Allow for temporal control by targeting either translation initiation or splice sites

For overexpression studies:

  • Plasmid-based expression:

    • Both constitutive and inducible expression systems have been successfully employed

    • Include epitope tags (such as Myc) for detection and immunoprecipitation studies

    • Consider including fluorescent protein fusions for live-cell imaging of localization and trafficking

  • mRNA injection:

    • Particularly useful for Xenopus and zebrafish embryo studies

    • Allows for dose-dependent analysis of TMEM88 effects

For gene editing:

  • CRISPR/Cas9 technology:

    • Enables generation of knockout cell lines or animal models

    • Can be used for precise introduction of mutations in specific domains (e.g., PDZ-binding motif)

    • Allows for tagging of endogenous TMEM88 for visualization and purification

When manipulating TMEM88 expression, researchers should verify alterations using multiple techniques (qPCR, Western blotting, immunofluorescence) and include appropriate controls to ensure specificity and rule out off-target effects.

How should researchers design luciferase reporter assays to study TMEM88's effects on Wnt signaling?

Luciferase reporter assays have been extensively used to quantify TMEM88's effects on Wnt signaling. Optimal experimental design should include:

Reporter constructs:

  • TOPflash reporter:

    • Contains TCF/LEF binding sites upstream of a minimal promoter driving luciferase expression

    • Widely used standard for measuring canonical Wnt/β-catenin activity

    • Include FOPflash (containing mutated TCF/LEF sites) as a negative control

  • Tissue-specific promoter reporters:

    • Siamois promoter-driven luciferase has been successfully used in Xenopus studies

    • Consider using promoters of known Wnt target genes relevant to your tissue of interest

Experimental conditions to include:

  • Titration of TMEM88 expression:

    • Transfect increasing amounts of TMEM88 expression plasmid to demonstrate dose-dependency

    • Include TMEM88 constructs lacking the PDZ-binding motif (TMEM88ΔC4) as functional controls

  • Activation methods:

    • Wnt ligand overexpression (e.g., Wnt-1 plasmid)

    • Expression of constitutively active signaling components (e.g., Xdsh, β-catenin)

    • Treatment with Wnt agonists like CHIR99021 (GSK3 inhibitor)

  • Essential controls:

    • Empty vector controls for all expression constructs

    • Co-transfection of a constitutively active luciferase (e.g., pRL-TK) for normalization

    • TMEM88 knockdown conditions to demonstrate reciprocal effects

  • Time course analysis:

    • Measure luciferase activity at multiple time points post-transfection

    • Consider using inducible expression systems for temporal control

A representative experimental paradigm should include transfecting cells with TOPflash reporter, a normalization reporter, and combinations of Wnt pathway activators with varying doses of wild-type or mutant TMEM88. Measuring luciferase activity 24-72 hours post-transfection will provide quantitative data on TMEM88's effects on Wnt signaling under different conditions.

How might TMEM88 serve as a diagnostic or prognostic biomarker in cancer?

TMEM88 shows significant potential as a diagnostic and prognostic biomarker in several cancer types, with evidence supporting its clinical utility:

In hepatocellular carcinoma (HCC):

In ovarian cancer:

  • TMEM88 promoter hypomethylation is associated with platinum resistance, suggesting potential use as a predictive biomarker for treatment response

  • TMEM88 mRNA expression levels are increased in platinum-resistant compared to sensitive samples, inversely correlating with promoter methylation levels

  • These findings suggest TMEM88 could help identify patients likely to develop resistance to platinum-based chemotherapy

For clinical implementation, researchers should:

  • Develop standardized assays for measuring TMEM88 expression or methylation status in tumor samples

  • Conduct large prospective clinical studies to validate cutoff values for risk stratification

  • Evaluate TMEM88 in combination with existing biomarkers to potentially improve prognostic accuracy

  • Investigate whether tissue-specific or subcellular localization-specific detection methods offer improved predictive value

What evidence suggests TMEM88 as a potential therapeutic target in disease?

TMEM88 shows promise as a therapeutic target in several disease contexts, with emerging evidence supporting its druggability:

In cancer:

  • In ovarian cancer, silencing TMEM88 can resensitize tumor cells to platinum drugs by alleviating inhibition of canonical Wnt/β-catenin signaling

  • In hepatocellular carcinoma, overexpression of TMEM88 attenuates tumor cell growth in cellular assays, suggesting that strategies to increase TMEM88 expression or activity might have therapeutic value

  • TMEM88 may influence tumor immune microenvironment, with higher TMEM88 positively correlating with NK cell, pDC, and CD8+ T cell enrichment in HCC, suggesting potential synergy with immunotherapeutic approaches

In cardiac development disorders:

  • TMEM88's critical role in cardiomyocyte specification suggests that modulating its activity might benefit congenital heart disease or cardiac regeneration approaches

  • The dose-dependent effect of TMEM88 on cardiomyocyte differentiation indicates that fine-tuning its expression levels could optimize therapeutic outcomes

In inflammatory conditions:

  • TMEM88 participates in inflammatory responses, promoting TNF-α-induced secretion of inflammatory factors in human hepatic stellate cells, suggesting it could be targeted in inflammatory liver diseases

Potential therapeutic strategies might include:

  • Small molecules that mimic TMEM88's inhibitory effect on Wnt signaling

  • Peptide inhibitors targeting the TMEM88-Dvl interaction

  • Epigenetic modifiers to regulate TMEM88 expression in disease states where it is dysregulated

  • Gene therapy approaches to restore TMEM88 expression in cancers where it functions as a tumor suppressor

When developing TMEM88-targeted therapies, researchers should account for its context-dependent roles across different tissues and disease states to minimize off-target effects.

What are the current challenges in translating TMEM88 research to clinical applications?

Several significant challenges must be addressed to translate TMEM88 research into clinical applications:

  • Context-dependent functions:

    • TMEM88 exhibits divergent roles across different cancer types and cellular contexts

    • Clinical applications must account for tissue-specific and subcellular localization-dependent functions

    • Personalized approaches may be needed based on individual patient characteristics

  • Signaling complexity:

    • TMEM88 interacts with the Wnt pathway, which is involved in numerous physiological processes

    • Targeting TMEM88 may have widespread effects beyond the disease tissue

    • The relationships between TMEM88 and other signaling pathways remain incompletely characterized

  • Technical barriers:

    • As a transmembrane protein, TMEM88 presents challenges for drug development

    • The lack of crystal structures limits structure-based drug design approaches

    • Current antibodies and detection methods may not distinguish between different isoforms or activation states

  • Translational gaps:

    • Most studies have been conducted in cell lines or animal models

    • Limited human data exists regarding TMEM88 expression patterns across diverse patient populations

    • Standardized biomarker assays for TMEM88 are not yet clinically validated

  • Therapeutic strategies:

    • Direct targeting of protein-protein interactions like TMEM88-Dvl remains challenging

    • The optimal timing for intervention may differ across diseases given TMEM88's developmental roles

    • Potential compensatory mechanisms that might emerge in response to TMEM88 modulation are unknown

Researchers can address these challenges through:

  • Comprehensive characterization of TMEM88 expression patterns in human tissue banks

  • Development of more specific tools to detect and modulate TMEM88 isoforms

  • Detailed mapping of TMEM88's interactome across different cell types

  • Comparative studies in diverse preclinical models to better predict translational success

  • Collaborative efforts between basic scientists and clinicians to design relevant proof-of-concept studies

What are the most promising unexplored areas of TMEM88 research?

Several promising research directions remain underexplored in the TMEM88 field:

  • Structure-function relationships:

    • Detailed structural characterization of TMEM88 beyond its C-terminal PDZ-binding motif

    • Identification of additional functional domains or motifs within TMEM88

    • Crystal structure determination in complex with interaction partners

  • Regulatory mechanisms:

    • Comprehensive characterization of TMEM88 regulation at transcriptional, post-transcriptional, and post-translational levels

    • Investigation of potential TMEM88 phosphorylation, ubiquitination, or other modifications that might modulate its function

    • Identification of microRNAs that regulate TMEM88 expression across different contexts

  • Signaling crosstalk:

    • Exploration of TMEM88's potential roles in signaling pathways beyond Wnt/β-catenin

    • Investigation of how TMEM88 might integrate signals from multiple pathways

    • Characterization of the complete TMEM88 interactome in different cellular contexts

  • Developmental biology:

    • Investigation of TMEM88's roles in tissues beyond the heart

    • Examination of potential evolutionary adaptations in TMEM88 function across species

    • Study of how TMEM88 contributes to tissue homeostasis in adult organisms

  • Immune system interactions:

    • Further investigation of TMEM88's correlation with immune cell enrichment in tumors

    • Exploration of potential direct effects on immune cell function or development

    • Study of TMEM88's role in inflammatory processes across different tissues

These research directions could yield significant insights into TMEM88's biological functions and therapeutic potential, addressing current knowledge gaps and potentially revealing novel applications for TMEM88-targeted interventions.

How might emerging technologies advance our understanding of TMEM88 biology?

Cutting-edge technologies offer exciting opportunities to advance TMEM88 research:

  • Single-cell analyses:

    • Single-cell RNA sequencing to map TMEM88 expression patterns with unprecedented resolution

    • Single-cell proteomics to detect TMEM88 protein levels and modifications in heterogeneous cell populations

    • Spatial transcriptomics to understand TMEM88 expression in the context of tissue architecture

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize TMEM88 subcellular localization and trafficking with nanometer precision

    • Live-cell imaging with fluorescent protein fusions to track TMEM88 dynamics in real-time

    • Multiplexed ion beam imaging (MIBI) or imaging mass cytometry (IMC) to simultaneously detect TMEM88 and dozens of other proteins in tissue sections

  • Genome editing technologies:

    • CRISPR activation/interference systems for precise temporal control of TMEM88 expression

    • Base editing or prime editing to introduce specific mutations in TMEM88 functional domains

    • CRISPR screens to identify genetic modifiers of TMEM88 function

  • Protein interaction mapping:

    • BioID or APEX proximity labeling to identify proteins in the vicinity of TMEM88

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes upon binding

    • Cryo-electron microscopy to visualize TMEM88 in complex with interaction partners

  • Organoid and in vitro models:

    • Patient-derived organoids to study TMEM88 in disease-relevant contexts

    • Microfluidic organ-on-chip systems to model TMEM88 function in complex tissue environments

    • Engineered cell lines with endogenously tagged TMEM88 for physiologically relevant studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.