TMEM93/EMC6 is implicated in:
Autophagy Regulation: Facilitates autophagosome formation by interacting with RAB5A (a GTPase) and BECN1 (a component of the PI3K complex) .
Membrane Protein Biogenesis: Part of the EMC, which stabilizes transmembrane domains (TMDs) during cotranslational insertion into the ER membrane .
Cholesterol Homeostasis: Indirectly influences cholesterol trafficking via interactions with proteins like TMEM97 and ABCA3 .
Recombinant TMEM93 is typically expressed in insect cells (e.g., SF9) or mammalian systems. Key steps include:
Detergent Screening: Solubilization using detergents for membrane protein stability .
Tag-Based Purification: Rho-1D4 or similar tags enable affinity chromatography .
Quality Control: Confirmed via SDS-PAGE, size-exclusion chromatography, and Western blot .
| Step | Details |
|---|---|
| Expression System | Baculovirus-infected SF9 insect cells |
| Purification Tags | Rho-1D4 epitope |
| Purity | >95% (crystallography grade) |
| Applications | Crystallography, ELISA, Western blot |
Autophagy Studies: TMEM93 knockdown in U2OS cells reduces LC3-II accumulation and autophagic flux .
Membrane Protein Dynamics: EMC6 depletion disrupts biogenesis of GABAA receptors and GPCRs like rhodopsin .
Disease Modeling: Linked to pancreatitis (apoptosis induction) and neurodegenerative disorders (via cholesterol trafficking) .
Bovine-Specific Data: No direct studies on bovine TMEM93 exist; current insights rely on cross-species homology.
Structural Details: Full-length atomic-resolution structures are lacking.
Mechanistic Studies: The interplay between EMC6 and lipid biosynthesis (e.g., phospholipids in Trypanosoma brucei) warrants further exploration .
TMEM93 (Transmembrane Protein 93) is also known as EMC6 (ER Membrane protein Complex subunit 6). It functions as a component of the ER membrane protein complex, which is involved in the insertion of transmembrane domains into the lipid bilayer. In scientific literature and protein databases, you may encounter both designations, with EMC6 being the more commonly used name in recent publications focused on its functional role within the ER membrane complex .
Bovine TMEM93 is a 110-amino acid protein with the following sequence:
MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASIILLSLLLILKARRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY
Structurally, while TMEM93/EMC6 was initially predicted to contain two transmembrane domains (TMDs) based on hydrophobicity profiles, more advanced structural prediction methods such as trRosetta have revealed that it actually forms a three-helix bundle . This structural arrangement is important for understanding its functional role within the EMC complex and its interactions with other proteins during membrane insertion processes.
Recombinant bovine TMEM93 is typically supplied as a lyophilized powder and should be stored at -20°C to -80°C upon receipt. For optimal stability, aliquoting is necessary to avoid repeated freeze-thaw cycles, which can compromise protein integrity.
When reconstituting the protein, it is recommended to:
Briefly centrifuge the vial before opening to bring contents to the bottom
Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL
Add glycerol to a final concentration of 5-50% (50% is commonly used)
For long-term storage, keep reconstituted protein at -20°C to -80°C in smaller working aliquots to prevent repeated freezing and thawing.
Recombinant bovine TMEM93 is typically expressed in E. coli expression systems, particularly when studying the full-length protein (amino acids 1-110). The protein is commonly tagged with an N-terminal His-tag to facilitate purification through affinity chromatography. The expressed protein is then purified and supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . Alternative expression systems such as mammalian or insect cells might be used for specific applications requiring post-translational modifications, though bacterial expression is most common for basic structural and functional studies.
TMEM93/EMC6 serves as a critical component of the ER Membrane protein Complex (EMC), which plays a specialized role in membrane protein biogenesis. The EMC facilitates the insertion of transmembrane domains (TMDs) that contain polar and/or charged residues, which are energetically unfavorable for spontaneous membrane insertion.
Research indicates that EMC6 contributes to the architecture of the complex that creates a path for membrane protein insertion. Structural analyses have revealed that EMC6 contains three transmembrane helices rather than the previously predicted two, which forms part of the insertion pathway for client proteins . The complex appears to operate through an energy-independent mechanism for membrane insertion of TMDs and accommodates only short lumenal domains .
The positioning of EMC6 within the complex allows it to interact with other EMC subunits, particularly EMC1 and EMC3, as demonstrated through crosslinking experiments where specific positions within the first TMD of EMC3 showed strong crosslinks with EMC1 .
Several sophisticated experimental approaches are employed to investigate TMEM93/EMC6 interactions:
Site-specific photocrosslinking: Researchers incorporate non-canonical amino acids like AbK (amber-suppressed lysine) at specific positions within TMDs to identify interaction partners through UV-induced crosslinking. This technique has revealed direct interactions between EMC subunits, including EMC6, and has helped map the architecture of the complex .
Mutagenesis studies: By introducing mutations that alter the polarity or charge of transmembrane domains, researchers can determine which proteins are dependent on the EMC for proper insertion. For example, replacing polar residues with hydrophobic ones in client proteins can convert EMC-dependent proteins to EMC-independent ones .
Quantitative proteomics: Tandem mass tagging (TMT)-based multiplexed quantitative proteomics has been used to identify EMC-dependent membrane proteins by comparing protein levels in wild-type versus EMC-deficient cells .
Topology mapping: Protease-protection assays have been employed to resolve discrepancies in the predicted topology of EMC6, confirming the three-TMD structure predicted by advanced computational methods like trRosetta .
The primary determinant of whether a membrane protein requires the EMC (including TMEM93/EMC6) for proper insertion is the presence of polar and/or charged residues within its transmembrane domains. These characteristics make TMD insertion energetically unfavorable without assistance.
Experimental evidence supporting this principle includes:
Analysis of EMC-dependent proteins revealed that they all contain at least one TMD with polar and/or charged residues .
Mutagenesis studies demonstrated that replacing polar residues (S, Q, T) with hydrophobic leucine in the C-terminal TMD of FDFT1 converted an EMC-dependent protein to EMC-independent .
Similarly, replacing polar (S284) and charged (R285) residues in the TMD of ZFPL1 with leucine made this protein EMC-independent .
Conversely, introducing polar residues into EMC-independent proteins like ERGIC3 (F344Y/L345N) or SEC61A1 (L89N, I90T, M91Q) converted them to become EMC-dependent .
This pattern is consistent across different membrane proteins, indicating that the EMC complex specifically handles TMDs containing residues that are challenging to insert into the lipid bilayer environment.
Distinguishing between direct and indirect effects of TMEM93/EMC6 knockout requires a multi-faceted experimental approach:
Complementation studies: Re-expressing EMC6 in knockout cells should restore the levels of direct client proteins. This approach can be expanded by using structure-guided mutations in EMC6 to identify essential functional domains .
Client protein mutagenesis: Converting EMC-dependent proteins to EMC-independent ones through mutations in their TMDs (as described above) can help identify direct clients of the EMC complex .
Time-course analyses: Monitoring the appearance of phenotypes following acute depletion of EMC6 can help distinguish primary (direct) from secondary (indirect) effects.
In vitro reconstitution: Purified components can be used in reconstitution assays to directly test the requirement for EMC6 in membrane insertion of specific client proteins.
Comparative proteomics: Examining changes in the proteome at different time points following EMC6 depletion can help establish a temporal hierarchy of effects.
A combination of these approaches provides more robust evidence for distinguishing direct clients from proteins affected indirectly through downstream perturbations in cellular homeostasis.
TMEM93/EMC6, as part of the EMC complex, functions in close relationship with cellular quality control mechanisms:
The EMC may protect nascent TMDs with polar and charged residues from being recognized by quality control machineries as misfolded membrane proteins, thus preventing their premature degradation .
EMC dysfunction can lead to increased engagement of ER-associated degradation (ERAD) pathways for client proteins that fail to insert properly.
Studies suggest that the EMC functions alongside, but distinct from, the Sec61 translocon, providing an alternative route for membrane protein insertion that is particularly important for proteins with challenging TMDs .
The relationship between EMC and quality control appears to be especially important for multi-pass membrane proteins like transporters and ion channels, which frequently contain polar/charged residues in their TMDs that are critical for their functions .
Understanding this relationship has implications for interpreting phenotypes associated with EMC6 deficiency, as some may result from activation of quality control mechanisms rather than direct failures in protein insertion.
For detecting TMEM93/EMC6 in experimental systems, researchers have several options:
For endogenous TMEM93/EMC6:
Commercial antibodies that detect endogenous levels of EMC6 are available, including polyclonal antibodies derived from human EMC6 peptides .
These antibodies can be used in applications including ELISA, immunohistochemistry (IHC), and immunofluorescence (IF) .
When selecting antibodies, verify species cross-reactivity as some antibodies recognize human and mouse TMEM93, while others have broader reactivity including cow, dog, and other species .
For recombinant tagged TMEM93/EMC6:
Anti-tag antibodies (such as anti-His for His-tagged recombinant protein) provide consistent detection regardless of the protein's conformation .
SDS-PAGE is a recommended application for analyzing recombinant His-tagged TMEM93, with expected purity greater than 90% .
When analyzing subcellular localization, consider that tag position may affect localization or function.
For both forms, western blotting conditions may need optimization due to the highly hydrophobic nature of this membrane protein. Sample preparation should include appropriate detergents for membrane protein solubilization, and heat denaturation time should be carefully controlled.
Studying TMEM93/EMC6 integration into experimental membrane systems requires specialized approaches for membrane proteins:
Detergent selection: Choose detergents carefully based on the experimental goals. Mild detergents like digitonin or DDM may preserve native interactions, while stronger detergents may be needed for complete solubilization.
Reconstitution into liposomes: For functional studies, the protein can be reconstituted into artificial lipid bilayers, which requires:
Careful detergent removal (dialysis or absorption)
Optimization of lipid composition to match native environment
Verification of correct orientation in the membrane
Nanodiscs or bicelles: These systems provide a more native-like membrane environment while maintaining solubility for biophysical studies.
Membrane insertion assays: To study the functionality of EMC6 within the EMC complex, researchers can develop assays using model substrate proteins with challenging TMDs containing polar/charged residues, and measure their successful integration into membranes in the presence or absence of functional EMC6 .
Fluorescence techniques: Techniques such as Förster resonance energy transfer (FRET) can be used to study the proximity and interaction of EMC6 with other complex components or client proteins when labeled with appropriate fluorophores.
When conducting functional studies on TMEM93/EMC6, researchers should be aware of several common pitfalls:
Confusing direct and indirect effects: Since EMC6 affects the biogenesis of numerous membrane proteins, many phenotypes observed in EMC6-deficient cells may be secondary effects. Use acute depletion systems and complementation studies to distinguish direct from indirect effects .
Overlooking redundancy: Some membrane proteins may have alternative insertion pathways, leading to partial rather than complete dependence on EMC6. Test for synthetic interactions with other insertion machinery components.
Tag interference: N- or C-terminal tags may interfere with protein function or complex assembly. Consider internal tagging strategies or validating that tagged proteins maintain native interactions and functions.
Species differences: While bovine TMEM93 shares high homology with human and mouse orthologs, species-specific differences in client proteins may exist. Verify findings across relevant species when possible.
Overexpression artifacts: Overexpression of EMC6 may disrupt the stoichiometry of the EMC complex. Use inducible or endogenous-level expression systems when possible.
Failure to control for membrane protein stability: As membrane proteins are often challenging to express and purify, include appropriate controls for protein stability and proper folding in your experimental design.
For characterizing TMEM93/EMC6 structure and interactions, several analytical techniques have proven effective:
Structural prediction algorithms: Advanced algorithms like trRosetta have successfully predicted the three-helix bundle structure of EMC6, correcting earlier predictions based on hydrophobicity alone .
Crosslinking mass spectrometry: Site-specific incorporation of photoreactive amino acids followed by crosslinking and mass spectrometry analysis has helped map interactions between EMC6 and other EMC subunits .
Blue native PAGE: This technique allows analysis of intact membrane protein complexes and can reveal subcomplexes or assembly intermediates containing EMC6.
Protease protection assays: These assays help determine the topology of membrane proteins like EMC6, confirming which regions are exposed to the cytosol versus protected in the membrane or lumen .
Co-immunoprecipitation: This approach can identify stable interactions between EMC6 and other proteins, though membrane protein interactions often require careful detergent selection.
Cryo-electron microscopy: Recent advances in cryo-EM have made it possible to resolve the structures of membrane protein complexes, potentially including EMC6 within the larger EMC complex.
Quantitative proteomics: TMT-based approaches can identify proteins whose levels depend on EMC6, providing insight into its functional role .
Understanding TMEM93/EMC6 function has significant implications for membrane protein biogenesis disorders:
Several EMC-dependent proteins identified in proteomic studies are transporters, ion channels, and other functional membrane proteins implicated in human diseases .
Multiple subunits of V-ATPase (ATP6V0A1, ATP6V0C, and TCIRG1) have been identified as EMC-dependent proteins, which may explain why EMC dysfunction affects processes requiring proper endosomal acidification, including viral pathogenesis and toxin translocation .
Defects in the insertion of membrane proteins with polar/charged residues in their TMDs may underlie certain congenital disorders characterized by misfolding or mislocalization of specific transporters or receptors.
The insight that EMC facilitates insertion of TMDs with specific challenging features (polar/charged residues) provides a framework for predicting which disease-associated membrane proteins might be affected by EMC dysfunction .
These findings suggest potential therapeutic strategies focused on enhancing membrane protein insertion pathways for disorders caused by unstable or poorly inserted membrane proteins containing challenging TMDs.
Several emerging techniques are poised to significantly advance TMEM93/EMC6 research:
Cryo-electron tomography: This technique allows visualization of membrane protein complexes in their native cellular environment, potentially revealing how EMC6 functions within the intact ER membrane.
In situ structural biology approaches: Methods like APEX2 proximity labeling combined with mass spectrometry can map the neighborhood of EMC6 in living cells.
Single-molecule tracking: Advanced imaging techniques allow tracking of individual molecules, potentially revealing the dynamics of EMC6 and its client proteins during membrane insertion.
Genome-wide CRISPR screens: These screens can identify genetic interactions with EMC6, revealing redundant pathways or unexpected connections to other cellular processes.
Artificial intelligence for structure prediction: Advances in AI-driven structural prediction (like AlphaFold) will continue to improve our understanding of EMC6 structure and its interactions within the EMC complex.
Organoid and tissue-specific studies: These approaches will help understand the tissue-specific roles of EMC6 in complex multicellular contexts, particularly in tissues with specialized membrane protein requirements.
High-throughput client identification: Development of systematic approaches to identify EMC clients based on TMD properties will expand our understanding of the scope of EMC6 function.