Recombinant Bovine Transmembrane protein C14orf176 homolog

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TMEM253; Transmembrane protein 253
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM253
Target Protein Sequence
MEDRAGQQERPSLRLEKLQHWARHRQSGRLLVLAVSQLWLAVAVVPFAVSVACLNSACHM TTALPLGPGILGLLTGIVTLELRRAPRLWKLAGLLVLELSAEAFTLGGVLVSAYSLFLLS QRKPRCCRSQSLRYQELQEGLSELEEVPELETGPTVASTAKRTNQ
Uniprot No.

Target Background

Database Links

KEGG: bta:515865

UniGene: Bt.41800

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Bovine Transmembrane protein C14orf176 homolog and how does it relate to NRAC?

Recombinant Bovine Transmembrane protein C14orf176 homolog belongs to a family of transmembrane proteins with significant similarity to the C14orf180 protein (which is closely related to C14orf176). This protein is also known as NRAC (Nutritionally-regulated adipose and cardiac-enriched protein homolog) and is identified by UniProt ID Q29RM6 . The protein consists of 159 amino acids and maintains the structural characteristics of transmembrane proteins, including hydrophobic regions that anchor it within cellular membranes. Research indicates that this protein shares homologous regions with human C14orf proteins, suggesting evolutionary conservation of function across species.

What expression systems are most effective for producing this recombinant protein?

Expression SystemAdvantagesLimitationsOptimal For
E. coliHigh yield, rapid growth, cost-effectivePotential improper folding of complex proteins, lack of post-translational modificationsBasic structural studies, antibody production
Pichia pastorisPost-translational modifications, proper protein folding, high yieldLonger expression time, more complex protocolsFunctional studies requiring native conformation
Mammalian cellsMost authentic post-translational modificationsLower yield, expensive, time-consumingStudies requiring fully authentic protein structure

For researchers prioritizing protein yield, E. coli systems with optimized codons and an N-terminal His-tag facilitate purification while maintaining reasonable yield rates.

What experimental approach should I use to study the function of this protein?

Designing experiments for functional characterization of Recombinant Bovine Transmembrane protein C14orf176 homolog requires a systematic approach focusing on key variables and controls . Start by clearly defining your dependent and independent variables:

  • Formulate a specific hypothesis based on predicted protein function (e.g., cellular localization, interaction partners, or response to stimuli)

  • Design appropriate controls, including negative controls (vector-only transfections) and positive controls (well-characterized related proteins)

  • Implement a stepwise characterization approach:

    • Subcellular localization using fluorescent protein tagging or immunocytochemistry

    • Protein-protein interaction studies using co-immunoprecipitation or proximity ligation assays

    • Functional assays based on predicted biological role (e.g., cell proliferation, migration)

    • Loss-of-function studies using siRNA or CRISPR-Cas9 technology

When measuring effects on cellular processes, ensure proper randomization of samples and blinding during analysis to minimize bias in your experimental design .

How can I identify and validate homologs of this protein in other species?

To identify and validate homologs across species, employ a structured bioinformatics approach followed by experimental validation:

  • Database Searching:

    • Search HomoloGene using the gene name and organism (e.g., NRAC AND bovine[orgn])

    • If no direct matches are found, search the Gene database with the gene name

    • Locate protein Reference Sequences in the NCBI Reference Sequences section

  • Sequence Analysis:

    • Use BLAST to compare protein sequences across species

    • Analyze conserved domains and motifs that may indicate functional conservation

    • Construct phylogenetic trees to visualize evolutionary relationships

  • Experimental Validation:

    • Express recombinant proteins from putative homologs

    • Compare biochemical properties and activities

    • Perform complementation studies in knockout models

This methodological approach ensures reliable identification of true homologs rather than simply sequence-similar proteins that may not share functional characteristics .

What are the optimal storage and handling conditions for this recombinant protein?

Proper storage and handling are critical for maintaining the integrity and activity of Recombinant Bovine Transmembrane protein C14orf176 homolog. Based on empirical data from similar proteins, implement these research-validated protocols:

  • Storage Recommendations:

    • Store lyophilized protein at -20°C to -80°C upon receipt

    • After reconstitution, aliquot to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution Protocol:

    • Briefly centrifuge the vial before opening to collect material at the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% for long-term storage

  • Quality Control Measures:

    • Verify protein integrity via SDS-PAGE before experiments

    • Monitor activity over time to establish stability under your specific laboratory conditions

These recommendations are based on experimental evidence showing that repeated freeze-thaw cycles significantly reduce protein activity, while proper glycerol addition preserves function during long-term storage .

How can I assess the structural integrity and purity of my recombinant protein preparation?

Assessment of structural integrity and purity requires multiple complementary analytical techniques:

  • Primary Analysis:

    • SDS-PAGE with Coomassie staining (target: >90% purity)

    • Western blotting with specific antibodies against the protein or tag

  • Advanced Structural Analysis:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Limited proteolysis to evaluate domain organization and stability

    • Dynamic light scattering (DLS) to determine homogeneity and aggregation state

  • Functional Verification:

    • Activity assays based on predicted function

    • Binding assays with known interaction partners

When interpreting purity data, remember that apparent purity by SDS-PAGE alone may not reflect functional purity, as denatured or misfolded proteins can appear as single bands but lack biological activity.

What approaches are most effective for studying protein-protein interactions involving this transmembrane protein?

Studying protein-protein interactions for transmembrane proteins presents unique challenges requiring specialized methodologies:

  • In vitro Approaches:

    • Pull-down assays using recombinant protein with His-tag as bait

    • Surface Plasmon Resonance (SPR) for real-time interaction kinetics

    • Microscale Thermophoresis (MST) for measurement in solution

  • Cellular Approaches:

    • Bioluminescence Resonance Energy Transfer (BRET)

    • Förster Resonance Energy Transfer (FRET)

    • Proximity Ligation Assay (PLA) for detecting native interactions

    • Split-ubiquitin yeast two-hybrid system (specialized for membrane proteins)

  • Proteomic Approaches:

    • Co-immunoprecipitation followed by mass spectrometry

    • BioID or APEX2 proximity labeling for capturing transient interactions

When designing these experiments, carefully consider the orientation of tags and fusion proteins, as they may interfere with transmembrane domain insertion or protein-protein interaction interfaces.

How does this protein compare to other known bovine transmembrane proteins in terms of stability and biological activity?

Comparative analysis of Recombinant Bovine Transmembrane protein C14orf176 homolog with other bovine transmembrane proteins reveals distinct physicochemical properties:

  • Stability Characteristics:

    • Similar to other bovine IFN proteins, this protein demonstrates stability at pH 2.0 and temperatures up to 65°C

    • The protein shows sensitivity to proteolytic enzymes like trypsin, indicating exposed cleavage sites

  • Biological Activity Profile:

    • The protein shares functional domains with nutritionally-regulated proteins expressed in adipose and cardiac tissues

    • Like other recombinant bovine proteins, it may exhibit antiviral and antiproliferative activities in specific cellular contexts

  • Comparative Protein Parameters:

ProteinMolecular WeightIsoelectric PointThermal StabilitypH StabilityTrypsin Sensitivity
C14orf176 homolog~17 kDa7.2-7.6Up to 65°CStable at pH 2.0-8.0High
BoIFN-α1419.5 kDa5.5-6.0Up to 65°CStable at pH 2.0High

These comparisons provide valuable context for researchers developing assays or interpreting experimental results.

What are common challenges in expression and purification of this protein, and how can they be addressed?

Researchers frequently encounter specific challenges when working with this transmembrane protein:

  • Expression Challenges:

    • Low expression levels due to membrane protein toxicity

    • Inclusion body formation in E. coli systems

    • Solution: Use specialized E. coli strains (C41/C43) designed for membrane proteins or consider expression as fusion with solubility-enhancing partners

  • Purification Difficulties:

    • Detergent selection for solubilization without denaturing

    • Co-purification of bacterial membrane components

    • Solution: Screen multiple detergents (DDM, LDAO, Fos-Choline) and implement additional purification steps (ion exchange, size exclusion)

  • Refolding Issues:

    • Difficulty achieving native conformation after purification

    • Solution: Employ gradual dialysis protocols and validate folding using CD spectroscopy

When troubleshooting, implement systematic variations of expression conditions (temperature, inducer concentration, expression duration) and document outcomes methodically to identify optimal parameters.

How can I design experiments to investigate the role of post-translational modifications of this protein?

Investigating post-translational modifications (PTMs) requires a multi-faceted experimental approach:

  • Prediction and Mapping:

    • Use bioinformatics tools to predict potential PTM sites

    • Design experiments targeting specific modifications (phosphorylation, glycosylation, etc.)

  • Detection Methods:

    • Mass spectrometry-based proteomics for comprehensive PTM mapping

    • Specific antibodies against common PTMs (phospho-specific, glyco-specific)

    • Mobility shift assays to detect modifications altering electrophoretic behavior

  • Functional Relevance:

    • Site-directed mutagenesis of predicted PTM sites

    • Compare activity between modified and unmodified protein forms

    • Temporal analysis of modification states under different cellular conditions

  • Expression System Selection:

    • For studying glycosylation patterns, mammalian or insect cell systems provide more authentic modifications than E. coli

    • For phosphorylation studies, consider co-expression with relevant kinases

This systematic approach allows researchers to not only identify PTMs but also understand their biological significance in protein function and regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.