Recombinant Bovine Transmembrane protein C5orf28 homolog

What is Bovine Transmembrane protein C5orf28 homolog?

Bovine Transmembrane protein C5orf28 homolog is a full-length protein (expression region 1-215) derived from Bos taurus with UniProt accession number Q17QJ2. It is characterized as a transmembrane protein with a specific amino acid sequence including: "MASETEKTHALLQSCSTESLLSSLGLGLFCTVADRLLQFPIIQQNAWLRALSDNSVHCVI GMWSWAIVIGIRKKTDFGEIILAGFLASVIDIDHFLLSGSLSLKAALSLPRRPFLHCSTV IPTVVLTLKFTMHFFKLKDSWCFLPWmLFISWTSHHIRDGIRHGLWMCPFGKTSPLPFWL YVIITSSLPHICSFVMYFTGTRQMMSSKHGIHIDV" . The protein is part of a conserved family with homologs found across different taxonomic groups including mammals, amphibians, and insects, suggesting important biological functions that have been preserved through evolution.

How is the recombinant form of C5orf28 homolog typically produced for research?

The recombinant form of Bovine Transmembrane protein C5orf28 homolog is typically produced through expression systems utilizing recombinant DNA technology. The process involves cloning the gene sequence into an appropriate expression vector, transforming host cells, inducing protein expression, and purifying the target protein. The recombinant protein is typically available with specific tag types that are determined during the production process and optimized for the particular protein characteristics . Following standard recombinant protein production protocols, the final protein is usually stored in a Tris-based buffer with 50% glycerol to maintain stability and functionality for research applications . Researchers should follow NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules when producing or working with these recombinant proteins .

What are the optimal storage conditions for Recombinant Bovine C5orf28 homolog?

For optimal preservation of Recombinant Bovine Transmembrane protein C5orf28 homolog integrity and activity, the protein should be stored at -20°C for standard research timeframes. For extended storage periods, conservation at -20°C or -80°C is recommended to prevent degradation and maintain functional properties . Working aliquots can be maintained at 4°C for up to one week to minimize freeze-thaw cycles, as repeated freezing and thawing is explicitly not recommended and can significantly compromise protein quality and experimental reproducibility . The protein is typically preserved in a Tris-based buffer containing 50% glycerol, which has been optimized specifically for this protein to enhance stability during storage . These storage parameters are critical for maintaining consistent experimental results when working with this recombinant protein.

How can evolutionary conservation of C5orf28 inform functional studies?

Evolutionary conservation analysis of C5orf28 can provide significant insights into its functional importance by examining syntenic relationships across species. Research indicates that C5orf28 maintains a conserved genomic organization across diverse vertebrate lineages, with evidence showing that CCL28 was consistently adjacent to C5orf28 in both Xenopus and human genomes, though their relative positions were rearranged through evolutionary processes . This conservation pattern extends beyond vertebrates, with C5orf28 homologs identified in diverse species including insects such as Agrilus planipennis (emerald ash borer) .

Functional studies can leverage this evolutionary conservation by:

• Designing comparative experiments that test conserved domains across species

• Identifying critical amino acid residues that remain unchanged across evolutionary time

• Developing hypotheses about protein function based on preserved genomic contexts

• Utilizing cross-species protein interaction studies to elucidate conserved molecular pathways

The presence of homologs across widely divergent species (from mammals to insects) strongly suggests fundamental biological importance and can guide experimental approaches to uncover the protein's core functions.

What methodological approaches are most effective for studying transmembrane protein interactions of C5orf28?

For investigating transmembrane protein interactions of C5orf28 homolog, a multi-faceted methodological approach is recommended. Based on the protein's structural characteristics with transmembrane domains , the following techniques yield complementary insights:

• Proximity-based labeling techniques:

  • BioID or APEX2 proximity labeling coupled with mass spectrometry

  • In situ analysis of protein neighborhoods within membrane environments

• Biophysical interaction analyses:

  • Surface plasmon resonance (SPR) with purified protein components

  • Microscale thermophoresis for measuring binding affinities in near-native conditions

• Advanced microscopy approaches:

  • Förster resonance energy transfer (FRET) for monitoring protein-protein interactions

  • Single-molecule tracking to analyze dynamic protein complexes

• Genetic modification strategies:

  • CRISPR-Cas9 mediated tagging for endogenous interaction studies

  • Domain-specific mutations to map interaction interfaces

These methods should be combined with bioinformatic analyses leveraging the known amino acid sequence to predict potential interaction interfaces and design validation experiments accordingly. The conserved nature of this protein across species boundaries can be exploited to validate interactions in multiple model systems.

What are the current hypotheses regarding the functional relationship between C5orf28 and CCL28?

Current research suggests a potentially significant functional relationship between C5orf28 and CCL28 based on their conserved genomic proximity across species. Genomic analysis reveals that CCL28 consistently appears adjacent to C5orf28 in both Xenopus and human genomes, though their relative positions have undergone evolutionary rearrangement . This conserved syntenic relationship suggests several hypotheses:

• Co-regulated expression hypothesis: The genomic proximity may facilitate shared regulatory elements, resulting in coordinated expression patterns under specific physiological conditions.

• Functional cooperation hypothesis: The proteins may participate in related biological pathways, potentially involving immune response coordination since CCL28 functions as a chemokine.

• Evolutionary constraint hypothesis: The maintenance of this genomic arrangement across diverse vertebrate lineages suggests selective pressure preserving a functional relationship between these genes.

Evidence from Xenopus studies indicates that CCL28 forms a phylogenetic clade with CCL27 and appears as an L singleton predominantly expressed in skin tissues , which may provide clues about tissue-specific functions that could involve C5orf28 through direct or indirect mechanisms. Experimental validation of these hypotheses requires coordinated expression analysis, interaction studies, and functional assays in appropriate model systems.

What controls should be implemented when performing functional assays with Recombinant Bovine C5orf28 homolog?

When designing functional assays with Recombinant Bovine Transmembrane protein C5orf28 homolog, a comprehensive control framework is essential for generating reliable and interpretable results:

• Protein-specific controls:

  • Empty vector-expressed protein preparations as negative controls

  • Heat-denatured C5orf28 samples to control for non-specific effects

  • Concentration gradient series to establish dose-dependent responses

  • Different tag configurations to control for tag interference with function

• Species comparison controls:

  • Parallel assays with C5orf28 homologs from different species (e.g., human, Xenopus, or insect homologs)

  • Chimeric constructs with domain swapping to identify functional regions

• Biological context controls:

  • Cell-type specific validations across relevant tissue contexts

  • Evaluations with and without potential interaction partners like CCL28

  • Pathway inhibitors to verify specificity of observed effects

• Technical validation controls:

  • Multiple independent protein preparations to control for batch effects

  • Storage time assessments to monitor potential activity degradation

  • Buffer-only conditions to control for vehicle effects

How should researchers design experiments to investigate the relationship between C5orf28 and chemokine expression?

Designing experiments to investigate the relationship between C5orf28 and chemokine expression requires a multi-level approach that addresses both genomic organization and functional interactions:

• Comparative expression analysis:

  • Perform parallel RNA-seq in multiple tissues comparing C5orf28 and nearby chemokines (especially CCL28)

  • Implement correlation analysis similar to the Pearson's correlation tests used in Xenopus studies to identify coordinated expression patterns

  • Design dual-reporter systems to simultaneously monitor expression of both genes in response to various stimuli

• Genomic manipulation experiments:

  • CRISPR-Cas9 mediated deletion of potential shared regulatory elements

  • Targeted mutations of C5orf28 followed by assessment of chemokine expression profiles

  • Chromosome conformation capture (3C/4C/Hi-C) to identify physical interactions between regulatory regions

• Functional interaction studies:

  • Co-immunoprecipitation experiments with tagged C5orf28 and chemokines

  • Proximity ligation assays to detect potential protein-protein interactions in situ

  • Signal pathway analysis following C5orf28 knockdown/overexpression

• Tissue-specific evaluations:

  • Focus on tissues with known high expression of CCL28 (like skin in Xenopus)

  • Organoid or tissue explant cultures for more physiologically relevant contexts

  • Immune cell migration assays in response to C5orf28 manipulation

Data analysis should include statistical methods similar to those used in comparative genomics studies, such as paired t-tests on log2-transformed expression data , to identify significant relationships between C5orf28 and chemokine expression patterns across experimental conditions.

What are the key technical challenges in expressing full-length C5orf28 homolog and how can they be addressed?

Expression of full-length Recombinant Bovine Transmembrane protein C5orf28 homolog presents several technical challenges due to its transmembrane nature. These challenges and their potential solutions include:

• Membrane protein solubility issues:

  • Challenge: Transmembrane proteins often aggregate during expression

  • Solution: Utilize specialized expression systems with membrane protein chaperones

  • Implementation: Incorporate mild detergents or amphipols during purification processes

• Preserving native conformation:

  • Challenge: Maintaining proper folding of transmembrane domains

  • Solution: Expression in eukaryotic systems (insect cells or mammalian cells) rather than bacterial systems

  • Implementation: Optimize buffer composition (as seen in the Tris-based, 50% glycerol formulation)

• Purification efficiency:

  • Challenge: Low yields common with membrane proteins

  • Solution: Strategic tag placement to avoid interference with transmembrane regions

  • Implementation: Implement tag types determined during production process specifically optimized for this protein

• Functional verification:

  • Challenge: Confirming proper insertion and orientation in membranes

  • Solution: Develop specific activity assays or conformation-sensitive antibodies

  • Implementation: Utilize the full amino acid sequence information to design validation approaches

• Storage stability:

  • Challenge: Maintaining functionality during storage

  • Solution: Follow specific storage guidelines (-20°C for standard storage, -80°C for extended periods)

  • Implementation: Prepare small working aliquots to avoid repeated freeze-thaw cycles

By addressing these challenges systematically, researchers can significantly improve the quality and consistency of experiments utilizing the full-length recombinant protein.

How should researchers analyze evolutionary conservation patterns of C5orf28 across species?

When analyzing evolutionary conservation patterns of C5orf28 across species, researchers should implement a systematic analytical framework:

• Sequence-based comparative analysis:

  • Perform multiple sequence alignments across diverse species (mammals, amphibians, insects)

  • Calculate conservation scores for specific domains and residues

  • Identify signature motifs that remain invariant across evolutionary distances

  • Analyze selection pressure (dN/dS ratios) across different protein regions

• Synteny and genomic context analysis:

  • Evaluate consistency of neighboring genes (particularly CCL28 and other chemokines)

  • Document genomic rearrangements while tracking gene positions relative to flanking genes

  • Create synteny maps across evolutionary time to visualize conservation patterns

  • Apply statistical approaches similar to those used in Xenopus studies to quantify conservation significance

• Structure-function relationship analysis:

  • Map conserved residues onto predicted protein structures

  • Identify conservation patterns in transmembrane domains versus cytoplasmic regions

  • Correlate evolutionary conservation with predicted functional sites

• Expression pattern comparison:

  • Analyze tissue-specific expression conservation across species

  • Implement correlation tests (Pearson's correlation) and statistical analyses (paired t-tests) as utilized in comparative genomics studies

  • Compare developmental expression timing across model organisms

This multi-faceted approach allows researchers to distinguish between core conserved features that likely represent essential functional elements and more variable regions that may reflect species-specific adaptations or neutral evolution.

What statistical approaches are most appropriate for analyzing C5orf28 expression correlation with potential interaction partners?

For analyzing expression correlation between C5orf28 and potential interaction partners (particularly chemokines like CCL28), the following statistical approaches are recommended:

• Correlation analysis frameworks:

  • Pearson's correlation tests for parametric assessment of linear relationships, as employed in Xenopus studies

  • Spearman's rank correlation for non-parametric assessment of monotonic relationships

  • Partial correlation analysis to control for confounding variables in complex datasets

• Expression level comparison methods:

  • Log2 transformation of expression data (e.g., log2(TPM+1)) to normalize distribution

  • Paired t-tests to evaluate differential expression between conditions or tissues

  • ANOVA with post-hoc tests for multi-condition comparisons

• Categorization frameworks:

  • Implementation of hierarchical categorization systems similar to those used in homeologous pair analysis:

    • High correlation (HC) vs. no correlation (NC) based on p-values from correlation tests

    • Same expression (SE) vs. different expression (DE) based on paired statistical tests

• Consistency validation approaches:

  • Analysis across biological replicates (e.g., "Clutch T and Clutch U" approach)

  • Exclusion of low-expression genes (e.g., TPM ≤ 0.5) from correlation analysis

  • Consistency checks across multiple tissues or developmental stages

• Visualization methods:

  • Heat maps for multi-tissue correlation patterns

  • Scatterplots with regression lines for pairwise comparisons

  • Principal component analysis to identify expression pattern clusters

These methodologies should be applied with appropriate adjustments for multiple testing and careful consideration of biological relevance thresholds.

How can researchers reconcile contradictory findings when studying C5orf28 function across different model systems?

Reconciling contradictory findings about C5orf28 function across different model systems requires a systematic approach to identify sources of variation and establish a coherent functional model:

• Systematic difference analysis:

  • Compare protein sequence homology percentages across species (bovine, human, Xenopus, insect)

  • Evaluate expression contexts (tissue types, developmental stages) across model systems

  • Document methodological differences in experimental approaches

• Integrative hypothesis development:

  • Formulate models that accommodate species-specific functional variations

  • Consider evolutionary divergence in protein-protein interaction networks

  • Develop testable predictions that would validate an integrated functional model

• Targeted validation experiments:

  • Design cross-species rescue experiments to test functional conservation

  • Perform domain swapping between homologs to identify regions responsible for functional differences

  • Conduct parallel experiments in multiple model systems using standardized protocols

• Context-dependent interpretation frameworks:

  • Establish whether contradictions represent true biological differences or experimental artifacts

  • Consider tissue-specific functions suggested by expression patterns (e.g., CCL28 skin expression in Xenopus)

  • Evaluate differences in genomic context that might influence function (e.g., syntenic relationships)

• Meta-analysis approaches:

  • Implement weighted evidence assessment based on methodological rigor

  • Conduct systematic reviews of available data across species

  • Develop consensus models that incorporate species-specific variations

This structured approach helps separate genuine functional differences that reflect evolutionary divergence from apparent contradictions resulting from methodological variations or incomplete data.

What does syntenic conservation reveal about the functional importance of C5orf28?

Syntenic conservation analysis of C5orf28 provides valuable insights into its functional significance across evolutionary timescales:

• Conserved genomic relationships:

  • C5orf28 maintains a consistent genomic proximity to CCL28 in both Xenopus and human genomes, despite evolutionary rearrangements in their relative positions

  • This conserved syntenic relationship suggests functional constraints maintaining this genomic organization

  • The preservation of these genomic relationships across diverse vertebrate lineages indicates selective pressure against separation

• Evolutionary implications:

  • Maintained synteny despite genomic reorganization suggests functional interdependence

  • Conservation across wide evolutionary distances (from amphibians to mammals) indicates ancient origins

  • Presence of homologs in highly divergent species like Agrilus planipennis (emerald ash borer) further supports fundamental biological importance

• Functional hypotheses generated:

  • Potential co-regulation of C5orf28 and CCL28 through shared regulatory elements

  • Possible involvement in conserved biological processes related to immunity (given CCL28's chemokine function)

  • Evolutionary constraints possibly preserving protein-protein interactions or pathway relationships

• Research directions suggested:

  • Investigation of shared transcriptional regulation mechanisms

  • Comparative analysis of expression patterns across tissues and developmental stages

  • Functional studies exploring potential interaction between these proximally encoded proteins

The conserved syntenic relationship provides a foundation for hypothesis-driven research exploring the functional significance of C5orf28 and its potential relationship with chemokine signaling networks.

How do expression patterns of C5orf28 vary across tissues and species, and what does this suggest about its function?

Comparative analysis of C5orf28 expression patterns across tissues and species reveals important insights about its biological functions:

• Cross-species expression patterns:

  • Genomic studies in Xenopus suggest potential co-expression patterns with neighboring chemokine genes

  • In Xenopus, the adjacent gene CCL28 shows L singleton expression predominantly in skin tissues

  • These expression patterns can be analyzed using correlation methods (Pearson's correlation) and statistical comparisons (paired t-tests) as implemented in comparative genomics studies

• Tissue-specific expression significance:

  • The predominant skin expression of neighboring CCL28 in Xenopus suggests potential involvement in epithelial barrier function or immune response

  • Expression pattern correlations can be categorized using frameworks like:

    • High correlation (HC) vs. no correlation (NC) based on correlation significance

    • Same expression (SE) vs. different expression (DE) based on expression level comparisons

• Developmental expression considerations:

  • Expression timing during oogenesis and embryogenesis of related genes provides context for C5orf28 function

  • Broad expression patterns of nearby genes (like CCL25) throughout development suggests potential homeostatic functions

• Methodological approaches for expression analysis:

  • RNA-seq transcriptome analysis with TPM normalization

  • Statistical validation across biological replicates

  • Exclusion of low-expression conditions (e.g., TPM ≤ 0.5) for reliable correlation analysis

The tissue-specific and developmental expression patterns, when analyzed across species, provide a foundation for understanding the conserved and divergent aspects of C5orf28 function in different biological contexts.

What approaches should be used to identify and characterize novel C5orf28 homologs in understudied species?

Identifying and characterizing novel C5orf28 homologs in understudied species requires a comprehensive strategy combining computational and experimental approaches:

• Computational identification methods:

  • Sequence-based homology searches:

    • Position-specific iterated BLAST (PSI-BLAST) using known C5orf28 sequences from bovine , human, and insect sources

    • Profile hidden Markov models (HMMs) constructed from multiple sequence alignments of known homologs

  • Synteny-based approaches:

    • Identification of genomic regions containing known C5orf28 flanking genes (particularly CCL28)

    • Whole-genome alignment tools to identify conserved genomic blocks

• Validation and characterization strategies:

  • Structural confirmation:

    • Transmembrane domain prediction in candidate sequences

    • Conserved motif identification across diverse species

  • Functional annotation:

    • Gene Ontology (GO) term assignment based on sequence features

    • Pathway analysis to predict functional associations

• Experimental verification methods:

  • Cloning and expression:

    • PCR amplification of predicted coding sequences

    • Recombinant expression following optimized protocols for transmembrane proteins

  • Functional assays:

    • Cross-species complementation tests

    • Antibody cross-reactivity studies

• Comparative analysis framework:

  • Phylogenetic tree construction to establish evolutionary relationships

  • dN/dS ratio analysis to identify selection patterns

  • Comparative expression profiling across multiple tissues

This multi-faceted approach facilitates reliable identification and functional characterization of novel C5orf28 homologs, contributing to our understanding of this protein's evolution and conserved functions across diverse species.

What compliance requirements should researchers follow when working with recombinant C5orf28 proteins?

Researchers working with Recombinant Bovine Transmembrane protein C5orf28 homolog must adhere to specific regulatory and compliance requirements to ensure safety and experimental integrity:

• Institutional biosafety considerations:

  • Follow current NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules (April 2024)

  • Submit appropriate documentation to Institutional Biosafety Committees (IBCs) before initiating research

  • Implement required containment measures based on risk assessment

• Laboratory safety protocols:

  • Follow institution-specific standard operating procedures for recombinant protein handling

  • Implement appropriate personal protective equipment requirements

  • Maintain proper documentation of all experimental procedures

• Material handling requirements:

  • Adhere to specific storage guidelines (-20°C for standard storage, -80°C for extended periods)

  • Follow recommendations against repeated freeze-thaw cycles

  • Store working aliquots at 4°C for maximum of one week

• Waste management procedures:

  • Follow institutional guidelines for disposal of recombinant materials

  • Implement appropriate decontamination procedures for work surfaces and equipment

  • Document all disposal activities according to regulatory requirements

• Training and documentation:

  • Ensure all personnel have appropriate training in recombinant DNA/protein handling

  • Maintain current knowledge of NIH Guidelines updates and amendments

  • Document all research activities in accordance with good laboratory practices

Compliance with these requirements is essential not only for regulatory adherence but also for ensuring experimental reproducibility and scientific integrity when working with recombinant C5orf28 proteins.

What experimental design modifications are needed when transitioning from in vitro to in vivo studies with C5orf28?

Transitioning from in vitro to in vivo studies with C5orf28 requires careful experimental design modifications to address increased complexity and regulatory requirements:

• Regulatory compliance extensions:

  • Follow NIH Guidelines sections specific to in vivo research with recombinant materials

  • Obtain IACUC (Institutional Animal Care and Use Committee) approval in addition to IBC approval

  • Implement appropriate animal biosafety level (ABSL) containment measures

• Protein preparation adaptations:

  • Modify storage buffer compositions to ensure biocompatibility with animal models

  • Validate protein stability in physiological conditions beyond the standard storage conditions

  • Develop and validate administration routes appropriate for the research question

• Experimental controls expansion:

  • Include additional control groups specific to in vivo contexts:

    • Vehicle-only controls with matched administration protocols

    • Non-recombinant protein controls to distinguish tag effects

    • Tissue-specific expression controls based on known distribution patterns

• Analytical methods adaptation:

  • Develop tissue-specific protein detection methods

  • Implement multi-parameter outcome assessments appropriate for complex in vivo responses

  • Design sampling protocols that account for pharmacokinetic considerations

• Cross-species considerations:

  • Evaluate homology between the bovine recombinant protein and the endogenous protein in the animal model

  • Consider species-specific differences in potential interaction partners (e.g., chemokines)

  • Design experiments that account for potential cross-reactivity issues

These modifications ensure scientific rigor, regulatory compliance, and appropriate translation of in vitro findings to more complex in vivo systems while maintaining experimental validity.

How should researchers approach the ethical considerations of developing transgenic models expressing C5orf28 variants?

Developing transgenic models expressing C5orf28 variants requires a comprehensive ethical framework addressing scientific, regulatory, and animal welfare considerations:

• Experimental justification assessment:

  • Document clear scientific rationale based on preliminary in vitro data

  • Demonstrate why alternative methods cannot address the research question

  • Establish expected knowledge gains relative to animal welfare impacts

• Regulatory compliance framework:

  • Follow NIH Guidelines sections specific to transgenic animal development

  • Obtain required institutional approvals (IACUC, IBC) prior to initiating work

  • Implement appropriate containment and housing conditions based on risk assessment

• Experimental design optimization:

  • Apply the 3Rs principles (Replacement, Reduction, Refinement):

    • Justification for animal models over alternative methods

    • Power analysis to determine minimum necessary sample sizes

    • Refined protocols to minimize distress and maximize data quality

• Animal welfare monitoring plan:

  • Develop comprehensive phenotyping protocols to detect unexpected effects

  • Establish clear humane endpoints based on potential C5orf28 functions

  • Implement non-invasive monitoring where possible to reduce distress

• Data sharing and transparency commitments:

  • Pre-register study designs and analysis plans

  • Commit to publishing results regardless of outcome

  • Share transgenic resources with the scientific community when appropriate

• Transgene design considerations:

  • Implement conditional/inducible expression systems to minimize developmental effects

  • Consider tissue-specific expression based on natural C5orf28 expression patterns

  • Design constructs that allow for precise monitoring of transgene expression

This ethical framework ensures responsible development of transgenic models expressing C5orf28 variants while maximizing scientific value and minimizing animal welfare concerns.