Recombinant Bovine Transmembrane protein C7orf23 homolog

Shipped with Ice Packs
In Stock

Description

Production and Expression

Recombinant versions are generated using heterologous expression systems:

  • Yeast Expression: Yields soluble protein with C-terminal Myc/DDK tags for purification .

  • E. coli and Baculovirus: Used for high-throughput production, though may lack eukaryotic post-translational modifications .

  • Mammalian Systems (e.g., HEK293): Enable native folding and membrane integration .

Critical parameters for stability include:

  • pH: 7.3 (Tris-HCl buffer).

  • Additives: Glycerol (up to 50%) for long-term storage .

Human TMEM243 (C7orf23)

  • Role: Associated with autosomal dominant intellectual disability .

  • Structure: Contains transmembrane domains critical for ER retention and membrane topology .

  • Interactions: Binds cytoskeletal components, suggesting roles in cellular architecture .

Bovine C9orf23 Homolog

  • Hypothesized Functions:

    • Membrane trafficking or signal transduction (based on Alba-like domain homology) .

    • Potential involvement in stress response pathways (inferred from yeast expression data) .

Applications and Experimental Use

  • Cell Culture: Used as a substrate for neuronal and oligodendrocyte differentiation .

  • Proteomics: Serves as a reference standard in mass spectrometry (C13/N15-labeled versions) .

  • Disease Modeling: Studied in knockout mice to elucidate transmembrane protein roles in development and immunity .

Comparative Analysis with Related Proteins

FeatureBovine C9orf23 HomologHuman TMEM243
Molecular Weight~13–25 kDa~13.4 kDa (unmodified)
Expression SystemsYeast, E. coliHEK293
Disease AssociationsNot yet characterizedIntellectual disability

Challenges and Future Directions

  • Nomenclature Conflicts: The bovine protein is annotated as C9orf23 homolog, while human homologs are designated C7orf23/TMEM243. This requires genomic context clarification .

  • Functional Studies: Limited in vivo data necessitate further research into signaling pathways and interactomes.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare your product accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. For precise delivery information, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preference for a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
TMEM243; Transmembrane protein 243
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM243
Target Protein Sequence
MEDFSTRTYGTSGLDNRPLFGETSAKDRIINLVVGSLTSLLILVTLISAFVFPQLPPKPL NIFFAVCISLSSITACILIYWYRQGDLEPKFRNLIYYILFSIIMLCICANLYFHDVGK
Uniprot No.

Target Background

Database Links

KEGG: bta:614280

UniGene: Bt.103433

Protein Families
TMEM243 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does the bovine C7orf23 homolog differ structurally from its human counterpart?

When comparing the bovine C7orf23 homolog with the human version, several key structural differences become apparent:

A detailed comparative analysis using structural modeling approaches would be beneficial for researchers to understand the functional implications of these differences.

What are the optimal conditions for reconstitution and storage of recombinant bovine C7orf23 homolog protein?

Based on standard protocols for similar recombinant proteins, the following conditions are recommended:

Reconstitution Protocol:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for long-term storage (50% glycerol is commonly used)

Storage Conditions:

  • Store at -20°C upon receipt; for extended storage, use -80°C

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Avoid repeated freezing and thawing as it may lead to protein denaturation

Buffer Composition:
The optimal storage buffer typically consists of a Tris-based buffer with 50% glycerol, specifically optimized for this protein .

What experimental design approaches are most effective for studying the function of bovine C7orf23 homolog in vitro?

When designing experiments to study bovine C7orf23 homolog function, consider the following methodological approach:

  • Variable Definition and Control:

    • Clearly identify independent variables (e.g., protein concentration, cell type, treatment conditions)

    • Define dependent variables (e.g., binding affinity, cellular localization, downstream signaling)

    • Control for extraneous variables that might influence results

  • Hypothesis Formulation:

    • Develop null and alternative hypotheses based on predicted protein function

    • Ensure hypotheses are specific and measurable

  • Treatment Design:

    • For overexpression studies: Transiently transfect cells (e.g., HEK293T) with 5μg of ORF cDNA plasmid using appropriate transfection reagent

    • For functional assays: Systematically vary protein concentration or mutate specific domains to assess function

  • Experimental Validation:

    • Confirm protein expression via Western blot using anti-tag antibodies (e.g., anti-His or anti-Myc)

    • Verify subcellular localization using immunofluorescence and membrane fractionation

    • Assess protein-protein interactions through co-immunoprecipitation or proximity ligation assays

  • Controls:

    • Include untransfected cells as negative controls

    • Use well-characterized membrane proteins as positive controls

    • Consider using the human homolog for comparative studies

How can structural modeling approaches be used to predict functional domains of bovine C7orf23 homolog?

Advanced structural modeling can provide significant insights into the bovine C7orf23 homolog's functional domains:

  • Ab Initio Protein Folding Predictions:

    • Leverage algorithms like AlphaFold2, trRosetta, or RaptorX to generate tertiary structure predictions

    • Assess structural similarity using Dali Z-scores and Template Modeling (TM)-scores

    • A TM-score closer to 1 indicates higher confidence in the structural model

  • Comparative Structure Analysis:

    • Compare predicted structures with experimentally determined structures of related proteins

    • Use tools like Foldseek for structure-based homology detection, though be cautious of false positives and negatives (with permissive settings, false positive rates can reach 73.3%)

  • Domain Identification and Functional Prediction:

    • Identify transmembrane regions, which are likely to span amino acids involved in membrane insertion

    • Look for conserved motifs that might indicate functional significance

    • Analyze potential binding sites or interaction surfaces

  • Evolutionary Conservation Analysis:

    • Map conserved residues between bovine, human, and other mammalian homologs

    • Highly conserved regions often indicate functional importance

    • Use this information to guide mutagenesis studies

This structural approach can guide experimental design, particularly for site-directed mutagenesis studies targeting functional domains.

What proteomic approaches can be used to study the role of bovine C7orf23 homolog in heat stress response?

Recent research on bovine proteomic responses to environmental stressors provides a framework for studying C7orf23 homolog in heat stress:

  • Sample Collection Protocol:

    • Collect blood samples during heat stress peak (HSP) and after recovery (HSR)

    • Use wet bulb globe temperature index and rectal temperature to assess heat stress levels

  • Proteomic Analysis Workflow:

    • Process plasma samples for liquid chromatography-tandem mass spectrometry (LC-MS/MS)

    • Conduct comparative analysis between HSP and HSR samples to identify differentially regulated proteins

    • Identify proteins with the highest absolute log-fold change values

  • Functional Enrichment Analysis:

    • Use tools like DAVID to evaluate functional enrichment

    • Analyze Gene Ontology biological processes and molecular functions

    • Identify significant REACTOME and KEGG pathways related to heat stress response

  • Protein-Protein Interaction Analysis:

    • Use STRING tool to map interaction networks

    • Determine if C7orf23 homolog interacts with other proteins involved in stress response

    • Visualize potential regulatory networks

  • Validation Studies:

    • Confirm differential expression using targeted approaches like Western blot

    • Assess cellular localization changes under heat stress conditions

    • Conduct in vitro functional assays under controlled temperature conditions

This methodological approach can help determine if bovine C7orf23 homolog plays a role in adaptive responses to heat stress, which is particularly relevant for livestock in warming climates.

How should researchers interpret conflicting experimental results when studying bovine C7orf23 homolog function?

When faced with conflicting experimental results regarding bovine C7orf23 homolog function, consider the following analytical approach:

  • Systematic Evaluation of Methodology:

    • Compare experimental designs, including sample preparation methods, protein tags used, and expression systems

    • Assess whether His-tagged versus Myc/DDK-tagged constructs might affect protein function differently

    • Evaluate if E. coli-expressed protein (common for bovine C7orf23) might differ functionally from proteins expressed in mammalian systems like HEK293T cells

  • Statistical Reanalysis:

    • Conduct meta-analyses of available data when possible

    • Calculate effect sizes and confidence intervals to determine the strength of conflicting findings

    • Consider whether sample sizes were adequate to detect true effects

  • Biological Context Assessment:

    • Examine cell type-specific effects (primary bovine cells vs. transformed cell lines)

    • Consider differences in experimental conditions (temperature, pH, ionic strength)

    • Evaluate whether post-translational modifications might explain functional differences

  • Experimental Reconciliation Strategy:

    • Design targeted experiments to directly address contradictions

    • Use multiple complementary techniques to measure the same outcome

    • Consider collaborative cross-validation with independent laboratories

  • Integration of Structural Insights:

    • Use structural modeling to predict how experimental conditions might affect protein conformation

    • Determine if specific amino acid differences between bovine and human homologs might explain conflicting results

This systematic approach helps differentiate true biological complexity from methodological artifacts.

What bioinformatic tools are most appropriate for comparative analysis of bovine C7orf23 homolog with homologs from other species?

For comprehensive comparative analysis of bovine C7orf23 homolog with other species, researchers should utilize the following bioinformatic tools and approaches:

  • Sequence-Based Analysis:

    • Multiple sequence alignment tools (MUSCLE, CLUSTAL Omega, T-Coffee)

    • Phylogenetic analysis software (MEGA, RAxML, MrBayes)

    • Conservation analysis tools to identify evolutionary constraints

  • Structure-Based Analysis:

    • Structure prediction tools (AlphaFold2, RoseTTAFold)

    • Structure alignment programs (DALI, TM-align)

    • Quantitative assessment of structural similarity using Z-scores and TM-scores

  • Functional Domain Prediction:

    • Transmembrane domain prediction (TMHMM, Phobius)

    • Signal peptide identification (SignalP)

    • Protein family assignment tools (InterProScan, PFAM)

  • Evolutionary Analysis:

    • Selection pressure analysis (PAML, HyPhy)

    • Ancestral sequence reconstruction

    • Coevolution analysis to identify functionally linked residues

  • Data Visualization and Integration:

    • Generate comprehensive tables of properties for comparative analysis

    • Include parameters such as molecular weight, sequence identity, structural similarity scores

    • Create visual representations of conservation mapped onto structural models

When applying these tools, researchers should pay particular attention to distinguishing between true homology and convergent evolution, especially when dealing with transmembrane proteins where structural constraints can lead to similar folds despite limited sequence identity.

What are the potential research applications of recombinant bovine C7orf23 homolog in understanding livestock adaptation to environmental stressors?

The recombinant bovine C7orf23 homolog presents several promising research applications for investigating livestock adaptation:

  • Biomarker Development:

    • Evaluate C7orf23 homolog expression levels in response to various stressors

    • Determine if expression changes correlate with physiological responses to heat stress

    • Assess potential as an early indicator of stress before clinical signs appear

  • Comparative Physiology Studies:

    • Compare expression and function between heat-tolerant and heat-susceptible cattle breeds

    • Investigate differences between Bos taurus taurus breeds in temperate versus tropical environments

    • Examine potential co-regulation with known heat shock proteins and stress response elements

  • Genetic Improvement Programs:

    • Identify genetic variants in the C7orf23 homolog gene associated with enhanced thermotolerance

    • Develop screening tools to identify animals with favorable genotypes

    • Explore potential for targeted breeding strategies to enhance climate resilience

  • Molecular Mechanism Investigation:

    • Determine if C7orf23 homolog interacts with pathways identified in heat stress proteomics

    • Investigate potential roles in immune system function, complement system, or hemostasis

    • Examine whether it influences mitochondrial function during stress conditions

These applications could significantly contribute to developing climate-resilient livestock production systems through both genetic improvement and management strategies based on molecular understanding of stress responses.

How might researchers design experiments to elucidate the role of bovine C7orf23 homolog in cellular signaling pathways?

To investigate the role of bovine C7orf23 homolog in cellular signaling, researchers should consider this comprehensive experimental design framework:

  • Protein Localization and Topology:

    • Express GFP-tagged C7orf23 homolog in bovine cell lines

    • Perform immunofluorescence microscopy with organelle-specific markers

    • Conduct protease protection assays to determine membrane orientation

    • Use subcellular fractionation to confirm membrane association

  • Interactome Mapping:

    • Perform immunoprecipitation followed by mass spectrometry (IP-MS)

    • Conduct proximity-dependent biotin identification (BioID) or APEX2 proximity labeling

    • Validate key interactions with co-immunoprecipitation and FRET/BRET assays

    • Create an interaction network using STRING or Cytoscape

  • Functional Perturbation:

    • Generate CRISPR/Cas9 knockout models in bovine cell lines

    • Create point mutations in predicted functional domains

    • Conduct overexpression studies using wild-type and mutant constructs

    • Perform rescue experiments to confirm specificity

  • Signaling Pathway Analysis:

    • Monitor changes in phosphorylation cascades using phospho-specific antibodies

    • Measure calcium flux using fluorescent indicators

    • Assess transcriptional responses through RNA-seq or qPCR of pathway target genes

    • Use pathway inhibitors to determine hierarchical relationships

  • Physiological Context:

    • Expose cells to relevant stressors (heat, oxidative stress, hypoxia)

    • Monitor changes in protein expression, localization, and interactions

    • Perform metabolic measurements to assess functional consequences

    • Compare responses between different bovine tissues or cell types

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.