Recombinant Bovine Transmembrane protein C9orf91 homolog

Shipped with Ice Packs
In Stock

Description

Genetic and Molecular Context

  • Gene Name: TMEM268 (synonyms: C9orf91)

  • Chromosomal Location: Bovine homolog maps to chromosome 9q32, flanked by DFNB31 and ATP6V1G1 genes .

  • Orthologs: Identified in primates, rodents, and Drosophila, but absent in simpler organisms .

Functional Insights from Research

Studies on human TMEM268 (orthologous to bovine C9orf91 homolog) reveal critical roles in cellular processes:

Cell Cycle Regulation

  • Knockout of TMEM268 in gastric cancer cells (BGC823 line) induced S-phase arrest via dysregulation of cyclins:

    • ↑ CCNE1/SKP2 (promotes G1/S transition)

    • ↓ CDKN1B/CCKN1C (inhibits cell cycle progression)

    • ↓ CCNB1/CDK1 (blocks S/G2-M transition) .

Cell Adhesion and Metastasis

  • TMEM268 deletion reduced adhesion to laminin (LN) and fibronectin (FN) by ↓ ITGB4 (integrin β4) and ↓ FLNA (filamin A) levels .

  • Rescue experiments confirmed TMEM268’s role in stabilizing ITGB4 post-translationally .

Research Applications and Availability

  • In Vitro Studies: Used to investigate transmembrane protein interactions and cell adhesion mechanisms .

  • Commercial Availability:

    • Formats: Lyophilized powder or glycerol-stabilized liquid .

    • Pricing: ~$1,698 for 50 µg ELISA-grade protein .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly specify them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For accurate delivery estimates, please consult your local distributor.
Please note: All our proteins are shipped with standard blue ice packs. Should you require dry ice shipping, kindly inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. You may use this as a reference.
Shelf Life
The shelf life of our products is influenced by multiple factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if feasible.
Synonyms
TMEM268; Transmembrane protein 268
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TMEM268
Target Protein Sequence
MACEPQMDPGGAAGPLPTSSPGWSPLPGGSPPGWGQELRSGQVLTVLRIDNTCAPISFDL GAAEEQLQTWGIQVPADQYRSLAESALLEPQVRRYIIYNSRPMRLAFAVVFYVVVWANIY STSQMFALGNHWAGVLLVTLAATSLTLTLVVIFERHQRKANTNTDLRLTAANGALLRHRV LLGVTDTVEGCQSVIQLWFVYFDLETCAQFLSDHIREMKMSQESLLRSRLSQLCVVMETG VSPTANEGPENLLEETPLLPDRPGSTEKPLMQTELRQLVPEAEPEEMAQQLLAVFGGYYT RLLVTSQLPQALGTRHMDSPRIPCPCQLIEAYILGTECCPFLTR
Uniprot No.

Target Background

Database Links

KEGG: bta:535122

UniGene: Bt.87703

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Transmembrane protein C9orf91 homolog and what is known about its function?

Transmembrane protein C9orf91 homolog (TMEM268) is a protein of approximately 342 amino acids with multiple transmembrane domains. This protein belongs to the domain of unknown function DUF4481, with the functional region located between amino acids 37 and 328 . Despite being conserved across species from fruit flies to mammals, its precise cellular function remains largely uncharacterized .

The protein contains two predicted transmembrane regions at positions 104-125 and 130-152, suggesting it may function in cellular membrane transport, signaling, or structural organization . Cross-species analyses indicate no identified paralogs within humans, zebrafish, or fruit flies, suggesting that TMEM268 may serve a unique functional role that has been conserved throughout evolution .

How should recombinant C9orf91 homolog be stored and handled for optimal stability?

For optimal stability and activity, recombinant C9orf91 homolog should be handled according to the following guidelines:

Storage ParameterRecommended Condition
Long-term storage-20°C to -80°C
Buffer compositionTris/PBS-based buffer with 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Glycerol addition5-50% final concentration (50% is standard)
AliquotingEssential to avoid repeated freeze-thaw cycles
Working storage4°C for up to one week

Prior to use, the vial should be briefly centrifuged to bring contents to the bottom . Repeated freeze-thaw cycles should be strictly avoided as they can lead to protein denaturation and loss of activity . When working with the reconstituted protein, maintaining sterile conditions is essential to prevent bacterial contamination.

What proteogenomic approaches can be used to identify SNPs and mutations in bovine C9orf91 homolog?

Proteogenomic analysis of C9orf91 homolog can be conducted using a systematic approach that integrates both genomic and proteomic data:

  • Mass Spectrometry-Based Analysis:

    • Collect unassigned tandem mass spectra from high-resolution mass analyzers using HCD fragmentation method

    • Merge unassigned spectra into peaklist files for specialized database searches

    • Apply search engines like SEQUEST and MASCOT with appropriate false discovery rate controls (typically 1% FDR)

  • Custom Database Construction:

    • Generate a customized protein database incorporating known and predicted SNPs from genomic databases

    • Include theoretical variant peptides resulting from documented mutations

    • Consider both synonymous and non-synonymous mutations that might affect peptide mass and fragmentation patterns

  • Analysis Pipeline:

    • Identify spectra that do not match to the reference proteome

    • Search these spectra against the custom database containing variant sequences

    • Validate identified variants using orthogonal methods such as targeted mass spectrometry or genomic sequencing

This approach has been successfully applied to human chromosome 9 proteins and can be adapted for the bovine homolog, allowing researchers to identify potentially functional variants that might affect protein structure or function .

How can experimental design be optimized for studying C9orf91 homolog in drug discovery applications?

Optimization of experimental design for studying C9orf91 homolog in drug discovery requires a strategic approach to navigate the vast biological hypothesis space efficiently:

  • Active Learning Frameworks:

    • Implement batch active learning algorithms to iteratively select the most informative experiments

    • Utilize prior knowledge from diverse information sources to guide experimental design

    • Apply reinforcement learning approaches to optimize exploration of the experimental space

  • CRISPR-Based Intervention Studies:

    • Design genetic interventions targeting C9orf91 homolog and related pathways

    • Use multiplexed CRISPR screens to assess functional impacts across diverse cellular contexts

    • Establish clear causal associations between the protein and phenotypic outcomes

  • Integrated Data Analysis:

    • Leverage standardized benchmarks like GeneDisco to evaluate experimental approaches

    • Incorporate multi-omics data to comprehensively characterize protein function

    • Apply machine learning models to extrapolate to unexplored areas of the experimental design space

The implementation of these approaches can significantly enhance the efficiency of experimental design, reducing resource requirements while maximizing valuable insights about C9orf91 homolog's potential as a drug target.

What expression systems are most effective for producing functional recombinant bovine Transmembrane protein C9orf91 homolog?

The selection of an appropriate expression system is critical for obtaining functional transmembrane proteins like C9orf91 homolog:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliCost-effective, high yield, rapid growthLimited post-translational modifications, inclusion body formationUse specialized strains (C41/C43), lower induction temperature (16-25°C), fusion with solubility-enhancing tags
Insect cellsBetter folding of complex proteins, post-translational modificationsMore expensive, slower productionOptimize virus-to-cell ratio, harvest timing, include protease inhibitors
Mammalian cellsNative-like folding and modifications, suitable for functional studiesHighest cost, complex maintenance, lower yieldsUse inducible systems, optimize transfection conditions, select stable cell lines
Cell-free systemsAvoids toxicity issues, direct access to reaction conditionsLimited scale, expensive reagentsSupplement with lipid nanodiscs or detergents for membrane proteins

How can comparative genomics and proteomics be applied to characterize the evolutionary conservation and divergence of C9orf91 homologs?

Comparative analysis of C9orf91 homologs across species provides valuable insights into functional conservation and species-specific adaptations:

  • Sequence Alignment and Phylogenetic Analysis:

    • Perform multiple sequence alignment of C9orf91 homologs from diverse species

    • Identify conserved domains and motifs that may indicate functional importance

    • Construct phylogenetic trees to visualize evolutionary relationships

    • Calculate sequence conservation scores to identify functionally critical regions

  • Structural Prediction and Comparison:

    • Generate predicted structural models using tools like AlphaFold

    • Compare predicted transmembrane topologies across species

    • Identify conserved structural features that may indicate functional constraints

    • Map sequence variations onto structural models to assess potential functional impacts

  • Expression Pattern Analysis:

    • Compare tissue-specific expression patterns across species

    • Identify conserved regulatory elements in promoter regions

    • Analyze co-expression networks to infer functional associations

    • Examine developmental expression patterns for evolutionary insights

Current evidence indicates that C9orf91 homologs are found in organisms ranging from insects to mammals, with no protein expression identified in organisms simpler than insects . This pattern of conservation suggests an important function that emerged with the evolution of complex multicellular organisms.

What are the key considerations for validating antibodies against bovine C9orf91 homolog?

Antibody validation is critical for ensuring specific detection of bovine C9orf91 homolog in experimental applications:

  • Epitope Selection and Antibody Design:

    • Target unique, accessible regions of the protein (avoiding transmembrane domains)

    • Consider generating antibodies against both N-terminal and C-terminal regions

    • Evaluate cross-reactivity with homologs from other species

    • For monoclonal antibodies, characterize the specific epitope recognized

  • Validation Methodology:

    • Perform Western blot analysis using recombinant protein as positive control

    • Confirm specificity using knockout/knockdown tissues or cells

    • Validate subcellular localization using immunofluorescence microscopy

    • Compare results from multiple antibodies targeting different epitopes

    • Perform immunoprecipitation followed by mass spectrometry to confirm target identity

  • Application-Specific Validation:

    • For immunohistochemistry: optimize fixation conditions and antigen retrieval methods

    • For flow cytometry: establish appropriate permeabilization protocols for transmembrane proteins

    • For ChIP applications: verify chromatin accessibility and antibody performance in chromatin context

Thorough antibody validation is essential for generating reliable and reproducible results in studies of C9orf91 homolog.

What potential role might C9orf91 homolog play in disease pathways based on current evidence?

While the specific function of C9orf91 homolog remains to be fully characterized, several lines of evidence suggest potential roles in disease pathways:

  • Cancer Associations:

    • Genes on chromosome 9 have been associated with various types of cancer, including lung cancer

    • Comparative proteomics between normal lung and lung cancer tissues has identified chromosome 9 proteins with differential expression

    • Some chromosome 9 proteins show cancer tissue-specific detection patterns

  • Genetic Variation Analysis:

    • SNPs and mutations in chromosome 9 genes have been documented in cancer databases like COSMIC

    • Proteogenomic approaches have identified peptide evidence of these variations

    • These genetic alterations may contribute to disease mechanisms through altered protein function

  • Structural and Functional Implications:

    • As a transmembrane protein, C9orf91 homolog may participate in cellular signaling or transport

    • Its evolutionary conservation suggests an important cellular function

    • The presence of multiple splice variants indicates potential for tissue-specific functions

Research exploring the specific role of bovine C9orf91 homolog in disease pathways would benefit from comparative studies with human and other mammalian homologs, particularly in contexts where chromosome 9 aberrations have been implicated in pathological processes.

What are the most promising research directions for elucidating the function of bovine C9orf91 homolog?

Based on current knowledge gaps and available research tools, several promising directions emerge for future investigation of bovine C9orf91 homolog:

  • Systematic Interactome Analysis:

    • Perform proximity labeling (BioID, APEX) to identify interaction partners

    • Conduct co-immunoprecipitation followed by mass spectrometry

    • Investigate protein-protein interactions across different cellular compartments and conditions

  • Advanced Functional Genomics:

    • Apply CRISPR-Cas9 knockout/knockin strategies to assess phenotypic consequences

    • Utilize tissue-specific conditional knockout models to address potential developmental lethality

    • Implement CRISPR interference/activation approaches to modulate expression levels

  • Structural Biology Approaches:

    • Determine high-resolution structure using cryo-EM or X-ray crystallography

    • Investigate membrane topology and dynamics using NMR or hydrogen-deuterium exchange

    • Apply computational modeling to predict functional sites and ligand interactions

  • Translational Research:

    • Explore association with bovine diseases and production traits

    • Investigate potential as a biomarker for specific pathological conditions

    • Assess cross-species conservation of function with implications for human health

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.