Recombinant Bovine Transmembrane protein ENSP00000340100 homolog

What is the Recombinant Bovine Transmembrane Protein ENSP00000340100 Homolog?

The Recombinant Bovine Transmembrane protein ENSP00000340100 homolog is a full-length protein (408 amino acids) derived from the bovine FAM205C gene (UniProt ID: Q32LN6). It is typically expressed in E. coli with an N-terminal His tag, allowing for simplified purification protocols. The protein features a transmembrane domain and multiple functional regions that are conserved across mammalian species. The commercially available recombinant form is typically supplied as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE analysis . The amino acid sequence begins with "MLSPTFILWDVGYPFYTYGSIIIIALIIWQVKKN" and includes multiple structural domains that contribute to its membrane-spanning functionality .

How does the Bovine Transmembrane Protein ENSP00000340100 differ from its homologs in other species?

The Bovine Transmembrane protein ENSP00000340100 (Q32LN6) shows notable sequence divergence from its rat homolog (Q642A3), particularly in length and specific amino acid composition. The bovine protein consists of 408 amino acids, while the rat homolog contains only 329 amino acids . Sequence alignment reveals conservation in the N-terminal transmembrane domains, but significant variation in the C-terminal regions. The rat protein begins with "MLIPPFILWDVGYSVYTYGSIFIIALIIWQVKR" compared to the bovine "MLSPTFILWDVGYPFYTYGSIIIIALIIWQVKKN," indicating partial conservation of the transmembrane domain . These differences may reflect species-specific functional adaptations and should be considered when designing cross-species comparative studies or when extrapolating findings between bovine and rodent models.

What are the recommended storage and handling conditions for this recombinant protein?

For optimal stability and activity retention, the lyophilized Recombinant Bovine Transmembrane protein ENSP00000340100 should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to avoid repeated freeze-thaw cycles . Working aliquots can be stored at 4°C for up to one week, but longer term storage requires lower temperatures . The protein is typically supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 . For reconstitution, researchers should first briefly centrifuge the vial to bring contents to the bottom, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Addition of glycerol (5-50% final concentration, with 50% being standard) is recommended for long-term storage to prevent freeze-thaw damage to the protein structure . These precise handling protocols are critical for maintaining protein integrity, particularly for transmembrane proteins which are notably sensitive to storage conditions.

What reconstitution protocol is recommended for experimental applications?

The recommended reconstitution protocol involves multiple steps to ensure optimal protein stability and activity. First, briefly centrifuge the vial containing lyophilized protein to ensure all material is at the bottom . Then, reconstitute the protein in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL . For applications requiring long-term storage of reconstituted protein, addition of glycerol to a final concentration between 5-50% is strongly recommended, with 50% being the standard concentration used by manufacturers . After reconstitution, the solution should be gently mixed to ensure complete solubilization without introducing air bubbles or causing protein denaturation. Aliquoting the reconstituted protein is essential to prevent multiple freeze-thaw cycles, which can significantly reduce protein activity . Each aliquot should be prepared based on the amount needed for individual experiments to minimize waste and maintain consistent protein quality across experiments.

What methodological considerations are critical when performing Western blotting with this transmembrane protein?

Western blotting of transmembrane proteins like ENSP00000340100 requires specific methodological considerations to obtain accurate results. One critical factor is sample heating prior to electrophoresis. Unlike soluble proteins, transmembrane proteins often exhibit better resolution and band clarity when samples remain unheated . Heating can cause aggregation of hydrophobic transmembrane domains, resulting in smeared bands or reduced signal intensity. Researchers should perform parallel experiments with heated and unheated samples to determine optimal conditions for this specific protein . Additionally, selection of detergents in lysis buffers significantly impacts protein extraction efficiency and subsequent detection. Standard SDS-PAGE protocols may require modification, including running gels at lower amperages (approximately 12.5mA per mini-gel for 1.5 hours) to improve resolution . Transfer conditions to PVDF membranes should be optimized at 300mA in transfer buffer containing 25mM Tris (pH 8.3), 192mM Glycine, and 20% methanol at 4°C for 1.5-2 hours . Blocking with either 1% BSA or 5% skim milk in 0.1% Tween 20-containing Tris-buffered saline has proven effective for transmembrane protein detection .

How can researchers optimize expression systems for producing functional Bovine Transmembrane Protein ENSP00000340100?

Optimizing expression systems for the Recombinant Bovine Transmembrane protein ENSP00000340100 requires careful consideration of several factors. While E. coli is commonly used for expression (as indicated in the commercial products) , researchers studying functional aspects of the protein may need to consider eukaryotic expression systems that better support proper folding and post-translational modifications of transmembrane proteins. For E. coli-based expression, codon optimization of the bovine sequence for bacterial expression is essential to enhance translation efficiency. Selection of appropriate fusion tags (beyond the standard His-tag) may improve solubility and membrane insertion. Consider testing multiple expression strains specifically designed for membrane proteins, such as C41(DE3) or C43(DE3). Temperature optimization during induction is critical—lower temperatures (16-20°C) often yield better results for transmembrane proteins by slowing expression and allowing proper folding. Induction conditions (IPTG concentration and duration) should be empirically determined through small-scale expression trials. For functional studies, mammalian or insect cell expression systems may provide superior results despite lower yield, as they better recapitulate the native membrane environment and post-translational modification machinery.

What are the challenges in studying protein-protein interactions involving this transmembrane protein?

Studying protein-protein interactions involving Bovine Transmembrane protein ENSP00000340100 presents several methodological challenges. The hydrophobic nature of its transmembrane domains can lead to non-specific interactions and high background in traditional co-immunoprecipitation approaches. Researchers must optimize detergent conditions that solubilize the protein while preserving native interactions—typically mild non-ionic detergents like digitonin (0.5-1%), DDM (0.1-0.5%), or CHAPS (0.5-1%) are recommended initial options. Cross-linking approaches may be necessary to capture transient interactions, using membrane-permeable crosslinkers like DSP or DSG at carefully titrated concentrations (0.1-2 mM) and reaction times (10-30 minutes). For in vivo interaction studies, proximity-based labeling methods such as BioID or APEX2 fusion constructs offer advantages by biotinylating nearby proteins, which can then be purified under denaturing conditions. Split-reporter systems (split-GFP, split-luciferase) adapted for membrane proteins can monitor interactions in living cells but require careful design of fusion constructs to ensure proper membrane topology is maintained. When designing experiments, researchers should consider controls for both specificity (using point mutations in predicted interaction domains) and subcellular localization (confirming proper membrane targeting of fusion constructs).

What considerations are important when designing CRISPR-based knockout or knockin studies targeting the bovine FAM205C gene?

When designing CRISPR-based genetic modifications of the bovine FAM205C gene (encoding Transmembrane protein ENSP00000340100), researchers must address several critical considerations. Guide RNA design should target early exons to ensure complete loss-of-function in knockout studies, with particular attention to avoiding off-target effects in homologous genes. For bovine cell lines or embryos, delivery methods must be optimized—typically nucleofection for cultured cells or microinjection for embryos, with optimal Cas9:gRNA ratios empirically determined (starting with 1:1 molar ratio). Homology-directed repair templates for knockin studies should include sufficiently long homology arms (800-1000bp for each arm) and consider codon optimization if introducing tagged versions of the protein. Verification of edits requires comprehensive strategies, including genomic PCR, sequencing, and Western blotting with antibodies against the target protein. For transmembrane proteins specifically, knockin designs must ensure that tags or modifications don't disrupt membrane insertion or topology. Cell viability assessment post-editing is essential, as complete knockout may be lethal if the protein serves essential functions. Finally, researchers should consider generating heterozygous models or conditional knockouts if homozygous loss proves lethal, potentially using Cre-loxP systems for tissue-specific or inducible deletion.

What purification strategy yields the highest purity and activity for this recombinant protein?

The optimal purification strategy for Recombinant Bovine Transmembrane protein ENSP00000340100 leverages its N-terminal His-tag while addressing the challenges inherent to membrane proteins . A multi-step approach begins with growth of transformed E. coli under optimized conditions (typically LB media, induction at OD600 0.6-0.8, with 0.1-0.5 mM IPTG at 16-20°C for 16-20 hours). Cell lysis should incorporate specialized detergents—begin with 1% n-dodecyl β-D-maltoside (DDM) or 1% Triton X-100 in phosphate buffer (50 mM sodium phosphate, 300 mM NaCl, pH 8.0) supplemented with protease inhibitors. Initial purification via immobilized metal affinity chromatography (IMAC) using Ni-NTA resin should employ a specialized protocol: binding in detergent-containing buffer (0.1% DDM), extensive washing (at least 20 column volumes) with increasing imidazole concentrations (10 mM, 20 mM, then 40 mM) to reduce non-specific binding, followed by elution with 250-300 mM imidazole. Secondary purification via size exclusion chromatography using a Superdex 200 column effectively removes aggregates and improves homogeneity. Throughout all steps, maintain detergent concentrations above critical micelle concentration to prevent protein aggregation. Purity assessment via SDS-PAGE should exceed 90%, with functional activity verified through specific binding assays or reconstitution into liposomes to confirm membrane insertion capability.

How should researchers approach experimental design for functional characterization of this protein?

Functional characterization of Bovine Transmembrane protein ENSP00000340100 requires a comprehensive experimental design approach addressing its membrane localization and potential functions. Begin with subcellular localization studies using fluorescently-tagged constructs or immunofluorescence with specific antibodies in relevant bovine cell lines to confirm predicted membrane targeting. For topological analysis, employ a combination of protease protection assays and site-directed epitope insertion followed by immunodetection under permeabilized and non-permeabilized conditions. Transport function assessment should utilize reconstitution into liposomes loaded with fluorescent indicators for potential transported molecules (ions, metabolites) or electrophysiological measurements in expression systems like Xenopus oocytes. For protein-protein interaction studies, implement membrane-specific approaches such as membrane yeast two-hybrid (MYTH) screening or proximity-based labeling (BioID, APEX) followed by mass spectrometry. Investigate tissue-specific expression patterns using qRT-PCR and immunohistochemistry across bovine tissues to identify physiologically relevant contexts. Functional effects of genetic manipulation can be assessed through CRISPR-mediated knockout in bovine cell lines followed by phenotypic characterization, including changes in membrane potential, cell morphology, growth rates, and response to relevant stimuli. Throughout experimental design, incorporate appropriate controls, including point mutations in predicted functional domains and comparative analysis with homologs from other species (such as the rat homolog) to identify conserved versus species-specific functions.

What analytical techniques provide the most comprehensive structural information for this transmembrane protein?

Comprehensive structural characterization of Recombinant Bovine Transmembrane protein ENSP00000340100 requires integration of multiple complementary analytical approaches. Cryo-electron microscopy (cryo-EM) represents the gold standard for transmembrane protein structure determination, requiring purification in detergent micelles or nanodiscs at concentrations exceeding 3 mg/mL and vitrification on specialized grids. X-ray crystallography, while challenging for membrane proteins, can provide high-resolution data if successful crystallization conditions are identified—typically employing lipidic cubic phase approaches or vapor diffusion with detergent screens (including DDM, LMNG, and GDN at various concentrations). For lower resolution but valuable topological information, hydrogen-deuterium exchange mass spectrometry (HDX-MS) offers insights into solvent-accessible regions and conformational dynamics without requiring crystallization. Cross-linking mass spectrometry using membrane-permeable, zero-length or variable-length crosslinkers provides distance constraints between amino acids. Circular dichroism spectroscopy in the far-UV range (190-260 nm) quantifies secondary structure content, particularly useful for monitoring alpha-helical transmembrane segments. Computational approaches should include transmembrane topology prediction, homology modeling based on structurally characterized homologs, and molecular dynamics simulations in explicit lipid bilayers to model membrane interactions. Integration of these methods creates a comprehensive structural model that captures both static architecture and functional dynamics within the membrane environment.

What statistical approaches are recommended for analyzing experimental data involving this protein?

Statistical analysis of experimental data involving Bovine Transmembrane protein ENSP00000340100 requires thoughtful approaches tailored to common experimental designs in membrane protein research. For expression optimization experiments comparing multiple conditions (constructs, cell lines, induction parameters), implement one-way or multi-factor ANOVA with appropriate post-hoc tests (Tukey's HSD for all pairwise comparisons or Dunnett's test when comparing to a control condition), ensuring at least three biological replicates per condition. When analyzing western blot densitometry data, employ normalization to housekeeping proteins (preferably multiple housekeepers) and assess normality (Shapiro-Wilk test) before choosing between parametric (t-test, ANOVA) or non-parametric (Mann-Whitney, Kruskal-Wallis) approaches. For binding or transport assays generating dose-response curves, non-linear regression analysis should fit appropriate models (typically Hill equation or similar) to extract parameters like EC50/IC50, Bmax, and Hill coefficient, with 95% confidence intervals reported. Time-course experiments benefit from repeated measures ANOVA or mixed-effects models that account for within-subject correlations. For functional assays comparing mutant constructs to wild-type, power analysis should guide sample size determination (typically aiming for 80% power to detect biologically meaningful effect sizes). Meta-analysis approaches can integrate results across multiple experimental platforms through standardized effect sizes. For all analyses, rigorous reporting should include exact p-values, effect sizes with confidence intervals, and transparent sharing of raw data to support reproducibility.

How can researchers address poor solubility and aggregation issues with this transmembrane protein?

Addressing solubility and aggregation challenges with Bovine Transmembrane protein ENSP00000340100 requires systematic optimization of multiple parameters. If protein precipitation occurs during purification or storage, implement a detergent screen testing 8-12 different detergents varying in head group chemistry and chain length, including DDM, LMNG, CHAPS, Triton X-100, and digitonin at concentrations ranging from 1-5x their critical micelle concentration (CMC). Addition of stabilizing agents can dramatically improve solubility—test glycerol (10-30%), specific lipids (particularly cholesterol at 0.01-0.1 mg/mL or E. coli lipid extract at 0.1-0.5 mg/mL), and osmolytes like sucrose (5-15%) or arginine (50-200 mM). Buffer optimization should explore pH ranges (6.5-8.5) and salt concentrations (100-500 mM NaCl) to identify conditions minimizing aggregation. If aggregation persists during expression, lower induction temperatures (16°C instead of 37°C) and reduce IPTG concentration (to 0.1-0.2 mM) to slow production rate and facilitate proper folding. For proteins prone to disulfide-mediated aggregation, addition of reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol) can be beneficial. Size-exclusion chromatography should be performed immediately after affinity purification to remove aggregates before they seed further aggregation. If traditional approaches fail, consider alternative solubilization strategies like SMALPs (styrene-maleic acid lipid particles) or nanodiscs that maintain a native-like lipid environment around the protein.

What strategies can improve detection sensitivity in Western blotting for this protein?

Improving Western blot detection sensitivity for Bovine Transmembrane protein ENSP00000340100 requires specialized approaches addressing the unique challenges of transmembrane proteins. Sample preparation represents the most critical step—avoid heating samples above 37°C as recommended for transmembrane proteins, which significantly improves resolution and band clarity . Optimize sample buffer composition by testing different detergent combinations (standard Laemmli buffer supplemented with additional 0.5-1% SDS, 0.5% Triton X-100, or 0.5% DDM) to enhance solubilization without causing aggregation. For protein extraction from tissues or cultured cells, use specialized membrane protein extraction kits or buffers containing 1% Triton X-100, 0.5% sodium deoxycholate, and 0.1% SDS in TBS with protease inhibitors. Transfer optimization is crucial—reduce transfer time and current while maintaining complete transfer by using a wet transfer system at 4°C with 20% methanol in the transfer buffer . For primary antibody binding, extend incubation time to overnight at 4°C with gentle rocking, and test both BSA (1%) and milk (5%) as blocking agents to determine which provides better signal-to-noise ratio . Signal amplification systems like biotin-streptavidin or tyramide signal amplification can increase sensitivity 10-100 fold compared to standard ECL detection. Loading higher protein amounts (50-100 μg per lane) may be necessary, but avoid overloading which reduces resolution. Finally, optimize exposure time during imaging, using incremental exposures to capture optimal signal before background development.

How should researchers address inconsistent results in functional assays with this protein?

Addressing inconsistent results in functional assays with Bovine Transmembrane protein ENSP00000340100 requires systematic troubleshooting across multiple experimental dimensions. Begin by implementing strict quality control measures for the recombinant protein—confirm purity via SDS-PAGE (>90%), verify intact molecular weight by mass spectrometry, and assess lot-to-lot variability through functional benchmarking assays. Protein storage conditions critically impact activity—test freshly purified protein against frozen aliquots to quantify activity loss during freeze-thaw cycles, and establish acceptance criteria for minimum specific activity. For reconstitution into artificial membranes or liposomes, standardize lipid composition (considering both headgroup chemistry and acyl chain length) and protein-to-lipid ratios through titration experiments, as these parameters dramatically influence protein orientation and activity. When expressing the protein in cellular systems, confirm proper membrane localization and topology through immunofluorescence and protease protection assays before interpreting functional data. Environmental variables including temperature (20-37°C), pH (6.5-8.0), and ionic strength (100-300 mM) should be systematically evaluated to identify optimal conditions and sensitivity to deviations. Establish positive controls using well-characterized transmembrane proteins with similar properties, preferably from the same protein family if known. For binding or transport assays, validate assay performance through Z'-factor determination (target Z' > 0.5) and implement internal standards in each experiment to enable normalization across experimental sessions. Finally, consider potential species-specific cofactors or interacting partners that may be required for full functional activity but absent in reconstituted systems.

What are common pitfalls in experimental design when working with this transmembrane protein?

Common pitfalls in experimental design when working with Bovine Transmembrane protein ENSP00000340100 span several research dimensions. One frequent error involves insufficient consideration of membrane environment—native membrane composition differs substantially between expression systems and target tissues, affecting protein function. Researchers should either reconstruct native-like lipid environments or acknowledge this limitation in interpreting results. Another critical oversight is inadequate validation of fusion constructs; tags for purification or visualization can disrupt transmembrane domain folding or topology. Always validate tagged constructs through parallel functional assays comparing N-terminal, C-terminal, and internally tagged versions. Control selection frequently proves problematic—appropriate negative controls should include both empty vector/untransfected controls and non-functional mutants (e.g., transmembrane domain point mutations) to distinguish specific from non-specific effects. Detergent selection represents another common pitfall; harsh detergents may efficiently extract the protein but denature it, while mild detergents may preserve structure but yield poor extraction. Systematic detergent screening is essential rather than defaulting to standard protocols. Time-dependent effects are often overlooked—membrane protein trafficking, internalization, and degradation dynamics can cause dramatic changes in localization and function over hours to days. Implement time-course experiments rather than single timepoint measurements. Finally, many researchers underestimate species-specific differences; even high-sequence-identity homologs can exhibit different functional properties, necessitating validation when translating findings between species (e.g., from bovine to rat models) .

What future research directions appear most promising for understanding the biological function of Bovine Transmembrane Protein ENSP00000340100?

Future research directions for Bovine Transmembrane protein ENSP00000340100 should integrate multiple approaches to elucidate its biological function. Comprehensive interactome mapping using proximity labeling methods (BioID or APEX2) in bovine cell lines would identify protein interaction networks, potentially revealing functional pathways. Parallel transcriptomic and proteomic profiling following gene knockdown or knockout via CRISPR would highlight dysregulated processes, indicating potential functional roles. High-resolution structural studies, particularly cryo-EM analysis of the protein in nanodiscs, would provide critical insights into functional domains and potential ligand-binding sites. Development of small molecule modulators through high-throughput screening approaches could yield valuable tool compounds for functional studies. Evolutionary analysis comparing orthologs across species beyond just rat and bovine would identify highly conserved regions likely critical for function. Tissue-specific expression profiling across developmental stages and physiological conditions would highlight contexts where the protein likely serves important roles. Identification of post-translational modifications through mass spectrometry could reveal regulatory mechanisms. Finally, generation of conditional knockout mouse models would enable physiological assessment of function in a mammalian system amenable to detailed characterization. Integration of data across these approaches through systems biology frameworks represents the most promising strategy for comprehensive functional understanding of this currently poorly characterized transmembrane protein.