Recombinant Bovine Transmembrane protein ENSP00000343375 homolog

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Transmembrane protein 247
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-217
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Protein Sequence
MATEDREMMEGRGAGESCPTFPKMAPDDPMSEGKPRASLPQEADTPKPDSSYDYLEEMET CEDGGCPGPPKVLSSKAGPATTKGQAGDGLELAELPSVPATAAPGSPVRERDAEMELEKV RMEFELKRLKYLHEENERQRQHEEVMEQLQQQATPRLFSGGLQDLLLPQNQFAMFLYCFI FIHIIYVTKEMIFFLFSKHYLFCIAAILLCLIKTLWS
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Bovine Transmembrane protein ENSP00000343375 homolog?

Recombinant Bovine Transmembrane protein ENSP00000343375 homolog (TMEM247) is a full-length (1-217 amino acids) transmembrane protein produced through recombinant DNA technology, typically expressed in E. coli with a histidine tag for purification purposes . The protein belongs to the transmembrane protein family and shares homology with mouse TMEM247 (Q497K7), which consists of 211 amino acids . The recombinant form is engineered to maintain the structural and functional properties of the native protein while allowing for enhanced purification, characterization, and experimental applications in research settings. In laboratory contexts, this protein is typically supplied as a lyophilized powder with high purity (>90% as determined by SDS-PAGE for the mouse homolog) .

How does one properly reconstitute lyophilized Recombinant Bovine Transmembrane protein ENSP00000343375 homolog?

Proper reconstitution of the lyophilized protein is crucial for maintaining its activity and stability. Begin by briefly centrifuging the vial to bring all contents to the bottom before opening. Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL . For long-term storage stability, add glycerol to a final concentration between 5-50% (with 50% being optimal for many applications) . After reconstitution, create small working aliquots to minimize freeze-thaw cycles, as repeated freezing and thawing significantly decreases protein stability and activity. Store the aliquots at -20°C/-80°C for long-term storage and keep working aliquots at 4°C for up to one week . Always handle the protein on ice when preparing experiments to minimize degradation.

What are the optimal storage conditions for maintaining the stability of Recombinant Bovine Transmembrane protein ENSP00000343375 homolog?

For optimal stability maintenance, store reconstituted Recombinant Bovine Transmembrane protein ENSP00000343375 homolog in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 . The protein should be stored at -20°C/-80°C for long-term storage, with appropriate aliquoting to prevent repeated freeze-thaw cycles that can compromise protein integrity . If working with the protein regularly, maintain working aliquots at 4°C for no longer than one week . When shipping or transferring the protein between laboratories, use dry ice and ensure temperature is maintained below -20°C. Monitor storage units regularly to ensure temperature consistency, as fluctuations can affect protein stability. Conduct periodic quality checks using SDS-PAGE or relevant functional assays to verify protein integrity during long-term storage.

What expression systems are typically used for producing Recombinant Bovine Transmembrane protein ENSP00000343375 homolog?

The predominant expression system for producing Recombinant Bovine Transmembrane protein ENSP00000343375 homolog is Escherichia coli (E. coli) . This prokaryotic expression system offers advantages including rapid growth, high protein yields, and cost-effectiveness. The protein is typically expressed with a histidine (His) tag to facilitate purification through immobilized metal affinity chromatography (IMAC) . For the mouse homolog, the full-length protein (1-211 amino acids) is successfully expressed in E. coli with N-terminal His tagging . While E. coli is most common, other expression systems that might be suitable include yeast systems (Pichia pastoris or Saccharomyces cerevisiae) for potential glycosylation, insect cell systems (baculovirus) for more complex folding requirements, or mammalian cell systems for proteins requiring specific post-translational modifications not achievable in prokaryotic systems.

How can I verify the purity and identity of the Recombinant Bovine Transmembrane protein ENSP00000343375 homolog?

To verify purity and identity of Recombinant Bovine Transmembrane protein ENSP00000343375 homolog, employ a multi-method approach. Begin with SDS-PAGE analysis to assess protein purity, which should exceed 90% as referenced for similar recombinant proteins . Western blotting using anti-His tag antibodies or antibodies specific to the target protein confirms identity while also assessing potential degradation products. Mass spectrometry (MS) provides precise molecular weight determination and peptide mapping when compared against theoretical values from the amino acid sequence. For functional verification, consider protein-specific activity assays based on known interactions or functions. Circular dichroism (CD) spectroscopy can verify proper protein folding by analyzing secondary structure elements. Additionally, N-terminal sequencing confirms the protein's identity by matching the first 5-10 amino acids with the expected sequence.

What experimental approaches can be used to determine the membrane topology of Recombinant Bovine Transmembrane protein ENSP00000343375 homolog?

Determining the membrane topology of Recombinant Bovine Transmembrane protein ENSP00000343375 homolog requires a combination of computational predictions and experimental validations. Begin with in silico analysis using algorithms like TMHMM, MEMSAT, or Phobius to predict transmembrane segments. For experimental validation, employ protease protection assays where the protein is reconstituted into liposomes or expressed in cells, then subjected to proteases that can only access exposed regions. Cysteine scanning mutagenesis combined with thiol-reactive reagents can identify accessible residues. Fluorescence resonance energy transfer (FRET) with fluorophores attached to different protein regions provides distance constraints between segments. Cryo-electron microscopy or X-ray crystallography, though challenging for membrane proteins, offers high-resolution structural information. Additionally, epitope tagging at various positions followed by immunofluorescence microscopy in non-permeabilized versus permeabilized cells helps determine which regions face the cytoplasm versus extracellular space. A comprehensive topology model should integrate results from multiple methodologies to overcome limitations of individual techniques.

How can I assess the protein-protein interactions of Recombinant Bovine Transmembrane protein ENSP00000343375 homolog?

To thoroughly assess protein-protein interactions of Recombinant Bovine Transmembrane protein ENSP00000343375 homolog, employ multiple complementary techniques. Begin with co-immunoprecipitation (co-IP) using antibodies against the His-tag or protein-specific antibodies, followed by mass spectrometry to identify binding partners. Yeast two-hybrid screening provides a high-throughput approach for identifying potential interactors, though results should be validated with other methods due to potential false positives. Bioluminescence resonance energy transfer (BRET) or fluorescence resonance energy transfer (FRET) can detect interactions in living cells with spatial and temporal resolution. Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) offers quantitative binding parameters including affinity constants and thermodynamic values. Proximity ligation assays visualize interactions in fixed cells with high specificity. For membrane proteins specifically, split-ubiquitin membrane yeast two-hybrid systems are valuable alternatives to conventional Y2H. Cross-linking mass spectrometry (XL-MS) can map interaction interfaces at amino acid resolution. Integrate data from multiple methods to build a comprehensive interactome, validating key interactions with functional assays specific to the biological pathway being investigated.

What are the challenges in producing functional Recombinant Bovine Transmembrane protein ENSP00000343375 homolog and how can they be overcome?

Producing functional Recombinant Bovine Transmembrane protein ENSP00000343375 homolog presents several challenges due to its hydrophobic transmembrane domains. First, insolubility issues often arise during E. coli expression, which can be addressed by optimizing growth conditions (lower temperatures of 16-20°C, inducer concentration adjustments) or using specialized E. coli strains designed for membrane protein expression. Protein misfolding can be mitigated by co-expression with molecular chaperones or using fusion partners like MBP or SUMO. Toxicity to host cells may occur, requiring tight regulation of expression using tunable promoters. For proper protein folding, consider detergent screening (DDM, LMNG, etc.) or amphipols for solubilization. Alternatively, cell-free expression systems provide an environment where detergents can be present during translation. Post-translational modifications may be required for function, potentially necessitating eukaryotic expression systems. Purification challenges can be addressed through optimized affinity chromatography conditions specific to membrane proteins, including suitable detergents in all buffers. Finally, functional assessment requires reconstitution into lipid bilayers, nanodiscs, or liposomes to mimic the native membrane environment for activity assays.

How can I design an effective experimental system to study the biological function of Recombinant Bovine Transmembrane protein ENSP00000343375 homolog?

Designing an effective experimental system for studying Recombinant Bovine Transmembrane protein ENSP00000343375 homolog requires a comprehensive approach. Begin with bioinformatics analysis to predict potential functions based on sequence homology, conserved domains, and evolutionary relationships. Develop both gain-of-function and loss-of-function models: overexpress the protein in relevant cell lines using inducible expression systems, and create knockout/knockdown models using CRISPR-Cas9 or RNA interference. For temporal control, consider using optogenetic or chemically-inducible dimerization systems. Develop fluorescent protein fusions to track subcellular localization while confirming these constructs retain native function. Complement cell culture studies with appropriate animal models (potentially using the mouse homolog TMEM247 ) to assess physiological relevance. Employ transcriptomics and proteomics to identify pathways affected by protein modulation. Design specific functional assays based on predicted cellular compartmentalization and potential roles in signaling, transport, or structural functions. For transmembrane proteins specifically, assess membrane integrity, ion flux, or transport activities using electrophysiology or fluorescent indicators. Throughout these studies, include appropriate controls including inactive mutants and rescue experiments to confirm specificity of observed phenotypes.

What computational tools and databases are most useful for analyzing sequence features and predicting functions of Recombinant Bovine Transmembrane protein ENSP00000343375 homolog?

For comprehensive analysis of Recombinant Bovine Transmembrane protein ENSP00000343375 homolog, utilize multiple specialized computational resources. For transmembrane topology prediction, employ TMHMM, MEMSAT, and Phobius, comparing results for consensus. Identify functional domains using InterPro, Pfam, and SMART databases. UniProt provides curated information including the mouse homolog entry (Q497K7) . For evolutionary analysis, perform multiple sequence alignments with MUSCLE or CLUSTALW, followed by phylogenetic tree construction using MEGA or PhyML to identify conserved regions suggesting functional importance. Predict post-translational modifications using NetPhos, NetOGlyc, or NetNGlyc. SubCellular localization prediction tools like DeepLoc and PSORT help confirm membrane association. Protein-protein interaction networks can be explored through STRING or BioGRID databases, while pathway involvement is accessible through KEGG or Reactome. For structural modeling, use I-TASSER or AlphaFold2, particularly valuable for transmembrane proteins with limited experimental structures. Protein aggregation tendency can be assessed with TANGO or AGGRESCAN. Integrate findings from multiple tools to overcome individual limitations, and validate computational predictions experimentally through targeted mutagenesis of predicted functional sites.

What are the recommended protocols for purifying Recombinant Bovine Transmembrane protein ENSP00000343375 homolog after expression?

Purification of His-tagged Recombinant Bovine Transmembrane protein ENSP00000343375 homolog requires specialized protocols for membrane proteins. Begin with bacterial cell lysis using either sonication or high-pressure homogenization in a buffer containing 20-50 mM Tris-HCl (pH 8.0), 150-300 mM NaCl, and appropriate protease inhibitors. For membrane extraction, add a suitable detergent (initial screening recommended among DDM, LMNG, OG, or Triton X-100) at concentrations above their critical micelle concentration. Incubate the lysate with the detergent for 1-2 hours at 4°C with gentle rotation. Clear the lysate by centrifugation at 20,000-40,000 × g for 30-60 minutes. For His-tagged protein purification, equilibrate Ni-NTA resin with binding buffer containing the selected detergent, then incubate with the cleared lysate for 1-2 hours at 4°C. Perform sequential washes with increasing imidazole concentrations (10-40 mM) while maintaining detergent presence. Elute the protein with 250-300 mM imidazole. For higher purity, implement size exclusion chromatography as a second purification step. Throughout purification, maintain sample temperature at 4°C and verify protein presence and purity in fractions using SDS-PAGE followed by Western blotting with anti-His antibodies. Final protein quality can be assessed by circular dichroism to confirm secondary structure integrity.

How can I develop a robust ELISA assay for detecting Recombinant Bovine Transmembrane protein ENSP00000343375 homolog?

Developing a robust ELISA for Recombinant Bovine Transmembrane protein ENSP00000343375 homolog requires careful optimization of multiple parameters. Begin by determining the optimal coating concentration by testing purified recombinant protein at 1-10 μg/mL in carbonate/bicarbonate buffer (pH 9.6) or PBS (pH 7.4). Coat high-binding polystyrene plates overnight at 4°C or for 2 hours at 37°C. After washing with PBS containing 0.05% Tween-20 (PBS-T), block non-specific binding sites with 1-5% BSA or casein in PBS for 1-2 hours at room temperature. For detection, evaluate both monoclonal antibodies against specific epitopes and anti-His antibodies for His-tagged versions, titrating to determine optimal concentrations. Incorporate a standard curve using purified protein (0.1-1000 ng/mL) to enable quantification. Add HRP-conjugated secondary antibodies and develop with TMB substrate, stopping the reaction with 2N H₂SO₄ before reading absorbance at 450 nm. Validate assay performance by determining the limit of detection, linear range, precision (intra- and inter-assay CV <15%), and recovery rates (80-120%). For specificity testing, include related proteins as negative controls. The final optimized protocol should yield a calibration curve with r² >0.98 and demonstrable specificity for the target protein.

What approaches can be used to generate specific antibodies against Recombinant Bovine Transmembrane protein ENSP00000343375 homolog?

Generating specific antibodies against Recombinant Bovine Transmembrane protein ENSP00000343375 homolog requires strategic approaches due to its transmembrane nature. Begin with epitope selection using bioinformatics tools to identify hydrophilic, surface-exposed regions with high antigenicity scores. For polyclonal antibody production, immunize rabbits with either purified full-length His-tagged protein or synthesized peptides (15-20 amino acids) from predicted extracellular/cytoplasmic domains conjugated to carrier proteins like KLH. Implement a prime-boost immunization schedule over 8-12 weeks with complete Freund's adjuvant for initial immunization followed by incomplete Freund's adjuvant for boosters. For monoclonal antibody development, immunize mice following similar protocols, then harvest splenocytes for fusion with myeloma cells to generate hybridomas. Screen hybridoma supernatants by ELISA against the immunizing antigen, with secondary screening against the native protein by Western blot and immunoprecipitation to confirm specificity. Cross-reactivity testing against homologous proteins, particularly the mouse homolog , is essential to determine species specificity. For enhanced specificity in difficult transmembrane regions, consider phage display technologies to select high-affinity recombinant antibodies or nanobodies. Characterize final antibodies thoroughly for applications including Western blotting, immunoprecipitation, immunofluorescence, and ELISA.

What methods are suitable for analyzing the post-translational modifications of Recombinant Bovine Transmembrane protein ENSP00000343375 homolog?

Analyzing post-translational modifications (PTMs) of Recombinant Bovine Transmembrane protein ENSP00000343375 homolog requires a multi-faceted mass spectrometry-based approach. Begin with enrichment strategies specific to anticipated modifications: immobilized metal affinity chromatography (IMAC) for phosphorylation, lectin affinity chromatography for glycosylation, and antibody-based enrichment for ubiquitination or acetylation. For comprehensive PTM mapping, perform bottom-up proteomics by digesting the purified protein with multiple proteases (trypsin, chymotrypsin, and Glu-C) to maximize sequence coverage. Analyze digested peptides using liquid chromatography-tandem mass spectrometry (LC-MS/MS) with electron transfer dissociation (ETD) or electron capture dissociation (ECD) fragmentation methods, which preserve labile modifications better than collision-induced dissociation (CID). Implement data-dependent acquisition for discovery and parallel reaction monitoring for targeted quantification of specific modified peptides. For intact protein analysis, use top-down proteomics with high-resolution instruments like Orbitrap or FTICR-MS. Complement mass spectrometry with site-specific detection methods including Western blotting with modification-specific antibodies (anti-phospho, anti-glycan) and specific staining techniques (Pro-Q Diamond for phosphoproteins, periodic acid-Schiff for glycoproteins). Validate key modification sites using site-directed mutagenesis followed by functional assays to determine their biological significance.

How should I design site-directed mutagenesis experiments to study structure-function relationships in Recombinant Bovine Transmembrane protein ENSP00000343375 homolog?

Designing effective site-directed mutagenesis experiments for Recombinant Bovine Transmembrane protein ENSP00000343375 homolog requires strategic selection of residues based on predicted structural and functional importance. Begin with computational analysis using multiple sequence alignments to identify evolutionarily conserved residues across species homologs, including the mouse TMEM247 . Prioritize highly conserved residues within transmembrane domains, potential ligand-binding regions, or protein-protein interaction interfaces. For transmembrane domains, target residues predicted to face the lipid bilayer versus the protein core separately. Create a mutation matrix including conservative substitutions (maintaining similar physicochemical properties) and non-conservative ones to assess the importance of specific chemical groups. For charged residues, consider charge reversal mutations (e.g., Arg to Glu) to test electrostatic interactions. When investigating potential functional motifs, create complete motif deletions alongside point mutations. Implement alanine-scanning mutagenesis systematically across regions of interest, as alanine eliminates side chain interactions beyond the β-carbon. For cysteine residues, evaluate their role in disulfide bond formation through serine substitutions. After generating mutants using PCR-based methods like QuikChange, verify each construct by sequencing before expression. Establish a comprehensive functional characterization pipeline including expression level assessment, subcellular localization studies, protein folding analysis, and function-specific assays to systematically evaluate the impact of each mutation on protein structure and function.

How can I design and analyze experiments to determine the membrane topology of Recombinant Bovine Transmembrane protein ENSP00000343375 homolog?

To experimentally determine the membrane topology of Recombinant Bovine Transmembrane protein ENSP00000343375 homolog, implement a multi-technique approach with rigorous data analysis. Begin with computational prediction using algorithms like TMHMM, MEMSAT, and Phobius to establish baseline expectations. For glycosylation mapping experiments, introduce N-glycosylation sites (N-X-S/T motifs) at various positions and express the protein in glycosylation-competent systems. Analyze glycosylation status by SDS-PAGE mobility shifts before and after endoglycosidase treatment, with glycosylated sites indicating extracellular/luminal orientation. For cysteine accessibility studies, introduce cysteine residues at predicted boundaries and use membrane-impermeable thiol-reactive reagents (e.g., MTSEA-biotin) to label accessible residues. Quantify labeling efficiency using streptavidin detection systems and plot accessibility as a function of amino acid position. For protease protection assays, express the protein in microsomes or reconstitute in proteoliposomes, then treat with proteases like trypsin or proteinase K with and without membrane permeabilization. Analyze digestion patterns by Western blotting with antibodies targeting different protein regions. Integrate data from all approaches using statistical methods like Bayesian inference to generate a consensus topology model, visualizing results in a transmembrane prediction plot that includes confidence intervals for each predicted domain orientation.

What statistical approaches are appropriate for analyzing protein-protein interaction data involving Recombinant Bovine Transmembrane protein ENSP00000343375 homolog?

Analyzing protein-protein interaction data for Recombinant Bovine Transmembrane protein ENSP00000343375 homolog requires tailored statistical approaches depending on the experimental method. For co-immunoprecipitation followed by mass spectrometry, implement significance analysis of interactome (SAINT) or CompPASS algorithms to distinguish true interactions from background contaminants. Calculate fold enrichment relative to control samples and apply false discovery rate (FDR) correction with a typical threshold of q < 0.05 or 0.01. For proximity labeling experiments (BioID, APEX), use similar enrichment calculations but account for spatial proximity effects. When analyzing yeast two-hybrid data, score interactions using growth on selective media with statistical analysis of reporter gene activation levels across biological replicates. For quantitative interaction methods like surface plasmon resonance or isothermal titration calorimetry, fit binding curves to appropriate models (one-site, two-site, cooperative binding) using non-linear regression and report dissociation constants (Kd) with confidence intervals. For FRET/BRET experiments, calculate energy transfer efficiency and use statistical tests like ANOVA with post-hoc analysis to compare different conditions. Network-level analysis should include centrality measures (degree, betweenness) to identify key interactors, and clustering coefficients to detect interaction modules. Visualize data using interaction networks with edge weights representing statistical confidence or interaction strength. For all methods, implement appropriate controls, perform power analysis to determine sample size, and validate key interactions using orthogonal techniques.

How should I interpret conflicting results from different experimental approaches when studying Recombinant Bovine Transmembrane protein ENSP00000343375 homolog?

When confronted with conflicting results from different experimental approaches studying Recombinant Bovine Transmembrane protein ENSP00000343375 homolog, implement a systematic reconciliation framework. First, critically evaluate the methodological limitations of each technique: expression systems may influence protein folding and post-translational modifications; purification methods might affect protein conformation; and different detergents can alter membrane protein behavior. Assess the sensitivity and specificity of each method, considering false positive and negative rates. For structural studies, resolution differences between techniques (X-ray crystallography versus NMR versus cryo-EM) can explain discrepancies. When functional assays yield contradictory results, examine if they measure direct or indirect effects, and whether cellular context influences outcomes. Consider protein concentration effects, as non-physiological concentrations may drive artificial interactions or activities. Perform orthogonal validation experiments specifically designed to resolve the conflict, ideally using complementary approaches that address known limitations of the original methods. When differences persist, develop testable hypotheses that could explain both sets of observations, such as conformation-dependent activities or context-specific functions. Implement Bayesian approaches to assign confidence weightings to different data points based on methodological robustness. Present all conflicting data transparently in publications rather than selectively reporting supportive results, and discuss possible explanations for discrepancies while acknowledging the need for further investigation of specific points of conflict.

What are the best practices for comparative analysis of Recombinant Bovine Transmembrane protein ENSP00000343375 homolog with its homologs across different species?

For rigorous comparative analysis of Recombinant Bovine Transmembrane protein ENSP00000343375 homolog with cross-species homologs like mouse TMEM247 , implement a comprehensive evolutionary and functional comparison framework. Begin with sequence-based analysis by performing multiple sequence alignment using MUSCLE or T-Coffee algorithms with gap penalty optimization for transmembrane regions. Calculate sequence identity and similarity percentages across full sequences and within functional domains separately. Identify absolutely conserved residues as candidates for essential functions. Generate a phylogenetic tree using maximum likelihood or Bayesian methods with appropriate substitution models for membrane proteins to visualize evolutionary relationships. For structural comparison, generate homology models using AlphaFold2 or Rosetta if experimental structures are unavailable, and calculate RMSD values between predicted structures focusing on transmembrane regions and potential functional sites. Compare predicted post-translational modification sites and their conservation. At the functional level, systematically compare expression patterns across tissues using transcriptomic databases, and assess subcellular localization using standardized cell biology techniques across species. When experimental data exists for one homolog but not others, design validation experiments using the table below to test conservation of specific properties:

Property to CompareBovine TMEM247Mouse TMEM247Other Homologs
Amino Acid Length217 211 (Fill as available)
Transmembrane Domains(Predicted #)(Predicted #)(Fill as available)
Key Functional Residues(Identify)(Identify)(Fill as available)
Interacting Partners(Experimental data)(Experimental data)(Fill as available)
Expression Pattern(Tissue distribution)(Tissue distribution)(Fill as available)

Document discrepancies carefully to identify species-specific adaptations versus experimental artifacts or annotation errors.

How can I develop a comprehensive research plan to elucidate the biological role of Recombinant Bovine Transmembrane protein ENSP00000343375 homolog?

Developing a comprehensive research plan for elucidating the biological role of Recombinant Bovine Transmembrane protein ENSP00000343375 homolog requires a systematic multi-phase approach spanning computational, biochemical, cellular, and physiological investigations. Begin with computational phase: perform exhaustive bioinformatic analysis including phylogenetic profiling, co-expression network analysis, and protein domain prediction to generate initial functional hypotheses. The biochemical characterization phase should include production and purification of the recombinant protein , followed by proteomic identification of interaction partners through affinity purification-mass spectrometry and structural studies using cryo-EM or X-ray crystallography if amenable. For the cellular phase, implement CRISPR-Cas9 knockout and inducible overexpression systems in relevant bovine cell lines, followed by phenotypic characterization including subcellular localization, effects on cellular morphology, proliferation, migration, and organelle function. Employ transcriptomic and proteomic profiling of modified cells to identify affected pathways. In the physiological relevance phase, develop appropriate animal models, potentially leveraging the mouse homolog initially . The table below outlines a suggested 3-year timeline with key milestones and contingency plans:

Research PhaseTimelineKey TechniquesMilestone DeliverablesContingency Plans
Computational AnalysisMonths 1-3Bioinformatics, Structure PredictionFunctional hypotheses, Predicted structural modelExplore alternative algorithms if initial predictions lack confidence
Protein ProductionMonths 3-6Recombinant expression, PurificationPurified protein, Antibody developmentTest multiple expression systems if E. coli yields are inadequate
Interaction StudiesMonths 6-12AP-MS, Y2H, SPRValidated interactomeImplement proximity labeling if conventional methods fail
Cellular FunctionMonths 12-24CRISPR-Cas9, Imaging, OmicsCellular phenotypes, Affected pathwaysUse RNAi if CRISPR efficiency is low
Physiological StudiesMonths 24-36Animal models, Tissue-specific analysisIn vivo function, Disease relevanceFocus on ex vivo tissue studies if animal models prove challenging

Include quarterly assessment points to evaluate progress and redirect resources as needed based on emerging data.

What emerging technologies could advance our understanding of Recombinant Bovine Transmembrane protein ENSP00000343375 homolog function?

Several cutting-edge technologies are poised to revolutionize our understanding of Recombinant Bovine Transmembrane protein ENSP00000343375 homolog function. Cryo-electron tomography combined with focused ion beam milling can visualize the protein in its native membrane environment at near-atomic resolution, revealing structural details previously inaccessible. Advanced AI-driven structural prediction tools like AlphaFold2 and RoseTTAFold are increasingly accurate for membrane proteins, offering insights even without experimental structures. Single-molecule techniques including FRET and force spectroscopy can capture dynamic conformational changes during protein function. Nanobody-based proximity labeling (TurboID or APEX2 fused to specific nanobodies) allows precise mapping of protein neighborhoods in specific conformational states. For functional analysis, optogenetic tools with millisecond temporal control permit precise manipulation of protein activity in cellular contexts. Spatial transcriptomics and proteomics can correlate protein function with specific subcellular domains. CRISPR-based epigenome editing technologies enable fine manipulation of gene expression without altering the underlying sequence. High-throughput microfluidic systems for membrane protein reconstitution facilitate rapid screening of functional conditions. For in vivo studies, genetically encoded biosensors can report on protein activation in real-time within living organisms. Integration of these technologies within a systems biology framework will be critical to developing a comprehensive understanding of this transmembrane protein's function within cellular networks and physiological contexts.

How might research on Recombinant Bovine Transmembrane protein ENSP00000343375 homolog contribute to understanding human disease mechanisms?

Research on Recombinant Bovine Transmembrane protein ENSP00000343375 homolog (TMEM247) could significantly contribute to understanding human disease mechanisms through comparative genomics and functional analysis across species. Begin by identifying the human ortholog through sequence homology and synteny analysis, then examine its genetic variations in disease databases like GWAS, ClinVar, and OMIM. If the human ortholog shows disease associations, the bovine protein can serve as a model for functional studies. Transmembrane proteins are critically involved in cellular communication, nutrient transport, and signal transduction—all processes frequently dysregulated in disease states. Specifically, TMEM family proteins have been implicated in various disorders including neurodegenerative diseases, cancer, and metabolic disorders. By elucidating the interactome of bovine TMEM247, researchers may identify conserved protein complexes relevant to human pathophysiology. Structural studies of the bovine protein could inform rational drug design targeting the human ortholog if validated as a therapeutic target. Additionally, understanding the bovine protein's role in specific cellular pathways may reveal novel biological mechanisms that are conserved in humans. If TMEM247 participates in fundamental cellular processes like autophagy, vesicular trafficking, or organelle homeostasis, insights from the bovine model would likely translate to human disease contexts, potentially revealing new therapeutic approaches for conditions involving cellular compartmentalization defects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.