Recombinant Bovine Transmembrane protein FAM155A (FAM155A)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine Transmembrane Protein FAM155A (FAM155A)

Recombinant Bovine Transmembrane protein FAM155A, also known as FAM155A, is a protein that, in humans, is primarily expressed in the hypothalamus and pituitary gland, with lower expression levels in the colon and blood . FAM155A is encoded by the FAM155A gene, which spans 703 kb and contains only three exons .

Gene Location and Structure

The FAM155A gene is located on chromosome 13 and spans a significant genomic region . It is characterized by a relatively simple structure, comprising only three exons within a 703 kb region .

Expression Patterns

FAM155A exhibits a distinct expression pattern across various tissues . It is predominantly expressed in the hypothalamus and pituitary gland . Lower expression levels have been observed in the colon and blood .

Association with Diseases

Genetic variations in FAM155A have been linked to an increased susceptibility to diverticulitis . The FAM155A variant rs67153654-A shows a significant association with diverticulitis .

Table 1: Association of FAM155A Variants with Diverticulitis

VariantAdjusted OR (95% CI)P value
FAM155A rs67153654:T (ta + aa vs tt)1.09 (0.84–1.00)0.53
FAM155A rs67153654:AT (ta vs tt + aa)1.02 (0.78–1.30)0.89
FAM155A rs67153654:TT (tt vs at + aa)1.19 (0.67–2.10)0.56

Interaction with NALCN

FAM155A functions as an auxiliary subunit of the human sodium leak channel NALCN . Structural analysis reveals that the C-lobe of FAM155A contains a fold similar to the frizzled-like cysteine-rich domain (CRD) of receptor tyrosine kinase MuSK . Three disulfide bonds are structurally conserved between FAM155A and the CRD domain of MuSK .

Role in Cancer

Somatic mutations in the FAM155A gene have been observed in various types of cancer .

Cross-Species Examination of FAM159B

FAM159B, a protein related to FAM155A, has been examined across human, rat, and mouse species, revealing differences in expression in pancreatic islets . These differences suggest that findings on FAM159B obtained in animal models may not always be directly transferable to humans .

FAM155A and Diverticulitis

The FAM155A variant rs67153654-A is associated with diverticulitis, particularly in individuals who have developed the condition . This variant is less frequent in diverticulitis cases compared to uncomplicated diverticular disease, suggesting a protective role against infection or inflammation rather than influencing the integrity of the colon wall .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Advance notification is required for dry ice shipping, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FAM155A; Transmembrane protein FAM155A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-457
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
FAM155A
Target Protein Sequence
MTRGAWMCRQYDDGLKIWLAAPRENEKPFIDSERAQKWRLSLASLLFFTVLLSDHLWFCA EAKLTRARDKEQQQQQQQQQQRQQRQRQEQRQRQRQHEPSWPALLASMGEPSPAAQAHRL LSASPSPTLPPSLGGGGGGKGGRGTDSRGKPPLPGNSARPAWRLETCYPQGASSGQCFTV DSADAVCARNWSRGAAARGEQGQQTRGPPQPTPLWNLSDFYLSFCNSYTLWELFSGLSSP NTLNCSLDVVLKEGGEMTTCRQCVEAYQDYDHHAQEKYEEFESVLHKYLQSEEYSVKSCP EDCKIVYKAWLCSQYFEVAQLNCRKTIPCKQYCLEVQTRCPFILPDNDEVIYGGLSSFIC TGLYETFLTNDEPECCDVRREAKPKSPSKGAGDRGGACPRTSLSASSAPRLGPSRLRLCV LVLMLLHTVLTASVAHNATALGVGGVHTLDERSASEE
Uniprot No.

Target Background

Database Links
Protein Families
FAM155 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is FAM155A and what is its primary function?

FAM155A (Family with Sequence Similarity 155 Member A), also known as NLF-1 (NCA Localization Factor 1), is an endoplasmic reticulum (ER) resident protein that functions as an auxiliary subunit of the NALCN (Sodium Leak Channel, Non-selective) channelosome. The primary function of FAM155A is to interact with NALCN and promote its neuronal localization . This interaction is crucial for the proper functioning of the sodium leak conductance, which plays a universal role in regulating the resting membrane potential (RMP) of neurons . FAM155A contains approximately 438-468 amino acids (depending on the species) and features a cysteine-rich domain (CRD) involved in signal transduction .

What structural features characterize FAM155A protein?

Based on recent structural studies, FAM155A contains:

  • One transmembrane domain near its C-terminus

  • A cysteine-rich domain (CRD) involved in signal transduction

  • One confirmed glycosylation site (Asn217)

  • Six disulfide bonds in its extracellular loops

  • Putative ER retention motifs at the amino-terminus region

The structure has been determined via cryo-EM at a resolution of 3.1 Å when complexed with NALCN . Electrostatic surface analysis revealed complementary surfaces between NALCN and FAM155A that ensure favorable interaction stability .

Structural FeatureDetailsReference
Glycosylation siteAsn217
Disulfide bondsSix bonds in extracellular loops
Transmembrane domainNear C-terminus
Cysteine-rich domainInvolved in signal transduction

How does FAM155A interact with the NALCN channel?

FAM155A forms a stable complex with NALCN through specific interaction surfaces. The interaction involves:

  • Complementary electrostatic surfaces between the two proteins

  • Key conserved residues that are specific to NALCN (not conserved in other Nav/Cav channels)

  • Interaction with the second transmembrane domain of NALCN

  • Requirement of NALCN's S5/P loop/S6 segment for binding

Cross-linking mass spectrometry analysis has confirmed this complex structure . The interaction is highly specific, as the key residues in NALCN that mediate binding to FAM155A are not conserved among other Nav/Cav channels . This explains the selective association of FAM155A with NALCN rather than with other ion channels.

What expression systems are optimal for studying recombinant FAM155A?

When designing experiments to study recombinant FAM155A, researchers should consider multiple expression systems based on their specific research questions:

  • HEK293FT cells: Suitable for electrophysiological studies of the NALCN-FAM155A complex, as demonstrated in patch-clamp recordings .

  • Xenopus laevis oocytes: Effective for studying interactions between FAM155A and NALCN pore .

  • E. coli, Yeast, Baculovirus, or Mammalian cell systems: All viable for recombinant protein expression depending on experimental requirements .

For structural studies requiring high protein yield and purity, insect cell expression systems have proven successful in obtaining stable NALCN-FAM155A complexes suitable for cryo-EM analysis . When designing functional studies, co-expression with other components of the channelosome (UNC79, UNC80) should be considered for a complete understanding of physiological function .

How should researchers design experiments to study FAM155A-NALCN interactions?

A methodological approach to studying FAM155A-NALCN interactions should include:

  • Define your variables:

    • Independent variable: Mutations in conserved residues of FAM155A

    • Dependent variable: NALCN current conductance

    • Control for extraneous variables such as expression levels, membrane trafficking, and cell health

  • Form a testable hypothesis:

    • For example: "Substitution of conserved residues in FAM155A will alter NALCN current conductance"

  • Experimental design:

    • Use site-directed mutagenesis to introduce specific amino acid substitutions in conserved residues of FAM155A

    • Co-express wildtype or mutated FAM155A with NALCN in a suitable expression system

    • Employ whole-cell patch-clamp recordings to measure changes in current properties

  • Control experiments:

    • Expression level verification via Western blot

    • Subcellular localization via immunocytochemistry

    • Protein-protein interaction verification via co-immunoprecipitation or FRET

This experimental design allows for systematic testing of the functional significance of specific residues in FAM155A for NALCN channel function .

What are the optimal methods for purifying recombinant FAM155A for structural studies?

Based on successful structural studies of the NALCN-FAM155A complex, the following purification protocol is recommended:

  • Expression system selection: Use HEK293 cells for mammalian expression or insect cells for higher yields

  • Purification strategy:

    • Solubilize membrane fractions with appropriate detergents

    • Utilize affinity chromatography (e.g., His-tag purification)

    • Apply size exclusion chromatography to isolate stable NALCN-FAM155A complexes

    • Consider glycerol addition for stability during storage

  • Quality control:

    • Verify protein purity (>90%) using SDS-PAGE

    • Confirm identity via mass spectrometry

    • Assess structural integrity through circular dichroism

For structural studies specifically, the protocol that yielded high-quality samples for cryo-EM involved gel filtration purification with careful selection of peak fractions, followed by concentration to approximately 8.5 mg/ml .

How can researchers accurately measure the functional effects of FAM155A mutations?

To accurately measure functional effects of FAM155A mutations:

  • Electrophysiological approaches:

    • Whole-cell patch-clamp recordings in heterologous expression systems

    • Analysis of current-voltage relationships

    • Measurement of voltage sensitivity and conductance properties

    • Assessment of changes in resting membrane potential

  • Data analysis parameters to measure:

    • Current density (pA/pF)

    • Voltage dependence of activation/inactivation

    • Reversal potential

    • Current kinetics (activation and inactivation rates)

As demonstrated in studies of NALCN mutations, electrophysiological analysis can reveal complex effects beyond simple increases or decreases in current magnitude. For example, the R1181Q mutation in NALCN was found to cause "significantly increased inward currents with a right shift, and reduced voltage sensitivity" rather than simply increasing conductance .

  • Additional functional assays:

    • Membrane trafficking assays to distinguish between trafficking defects and functional changes

    • FRET-based interaction assays to measure changes in protein-protein interaction strength

    • Surface biotinylation to quantify membrane expression levels

How does FAM155A research contribute to understanding neurological disorders?

FAM155A research has significant implications for understanding neurological disorders through its critical role in the NALCN channelosome:

  • Neurodevelopmental disorders:

    • Mutations in NALCN cause CLIFAHDD (Congenital contractures of the limbs and face, hypotonia, and developmental delay) and IHPRF1/2 (Infantile hypotonia with psychomotor retardation and characteristic facies)

    • As an essential auxiliary subunit, FAM155A dysfunction may contribute to similar phenotypes

  • Neurophysiological mechanisms:

    • FAM155A influences the resting membrane potential (RMP) by modulating NALCN function

    • Alterations in RMP affect neural circuit dynamics and neuronal excitability

    • Understanding these mechanisms provides insight into the pathophysiology of excitability disorders

  • Therapeutic potential:

    • FAM155A represents a potential therapeutic target for modulating neuronal excitability

    • Understanding the structural basis of FAM155A-NALCN interaction could facilitate drug design targeting this complex

Research focused on the role of FAM155A in the sodium leak channelosome contributes fundamentally to understanding how neurons maintain their resting potential and how disruption of this process leads to disease .

What are the evolutionary implications of FAM155A conservation across species?

The evolutionary conservation of FAM155A has several important implications:

  • Functional conservation:

    • Mouse homologs of NLF-1/FAM155A functionally substitute for C. elegans orthologs

    • Knockdown of Drosophila ortholog (CG33988) results in similar phenotypes to NALCN mutation

    • This high degree of functional conservation suggests a fundamental role in neuronal physiology

  • Structural conservation:

    • Key residues mediating NALCN-FAM155A interactions are highly conserved across species

    • This conservation suggests strong evolutionary pressure to maintain this interaction

  • Paralog evolution:

    • Humans possess a paralog, FAM155B (located on Xq13.1)

    • FAM155B shares key structural features with FAM155A, including the cysteine-rich domain

    • The conservation of key interface residues suggests FAM155B may also interact with NALCN

This evolutionary conservation highlights the fundamental importance of the NALCN-FAM155A interaction in neuronal physiology across the animal kingdom and suggests that insights gained from model organisms are likely applicable to human physiology and disease.

What are common challenges in FAM155A expression and purification, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant FAM155A:

  • Low expression levels:

    • Solution: Optimize codon usage for the expression system

    • Solution: Use stronger promoters or inducible expression systems

    • Solution: Consider fusion tags that enhance expression (e.g., SUMO tag)

  • Protein instability:

    • Solution: Include glycerol in storage buffers (as indicated in commercial preparations)

    • Solution: Store working aliquots at 4°C for up to one week; use -20°C or -80°C for long-term storage

    • Solution: Avoid repeated freeze-thaw cycles

  • Poor solubility:

    • Solution: Express as a complex with NALCN rather than in isolation

    • Solution: Optimize detergent selection for membrane protein solubilization

    • Solution: Consider using nanodiscs or amphipols for maintaining native-like membrane environment

  • Ensuring proper folding:

    • Solution: Verify the formation of critical disulfide bonds

    • Solution: Confirm glycosylation at Asn217

    • Solution: Use CD spectroscopy to assess secondary structure

Based on successful structural studies, co-expression with NALCN appears to be particularly effective for obtaining stable, properly folded FAM155A protein suitable for biochemical and structural analyses .

How can researchers troubleshoot inconsistent electrophysiological results when studying FAM155A-NALCN complexes?

When encountering inconsistent electrophysiological results:

  • Verify protein expression levels:

    • Perform Western blot analysis to confirm consistent expression of all components

    • Use fluorescently tagged constructs to visualize expression in individual cells

  • Check membrane localization:

    • Perform surface biotinylation assays

    • Use confocal microscopy with membrane markers

    • Remember that NLF-1/FAM155A is an ER resident protein that affects NALCN trafficking

  • Ensure complete complex formation:

    • For full function, the complete NALCN-FAM155A-UNC79-UNC80 complex may be required

    • Consider co-expressing all components for physiologically relevant results

  • Control for recording conditions:

    • Standardize pipette and bath solutions

    • Control temperature during recordings

    • Account for series resistance and cell capacitance

    • Use consistent voltage protocols

  • Consider cell health and viability:

    • NALCN leak currents may affect cell viability

    • Use inducible expression systems to limit exposure time

Remember that when reconstituted in exogenous host cells, mutations can exert complex effects beyond simple increases or decreases in conductance, as demonstrated with the R1181Q NALCN mutation .

What are the most promising research directions for understanding FAM155A function?

Based on current knowledge gaps, several promising research directions emerge:

  • Structural studies of the complete channelosome:

    • While the structure of NALCN-FAM155A is known, the complete structure including UNC79 and UNC80 remains to be determined

    • Understanding how all components interact could reveal regulatory mechanisms

  • Investigation of FAM155B function:

    • Determine whether FAM155B can substitute for FAM155A

    • Characterize potential tissue-specific expression patterns and functions

    • Investigate whether FAM155B interacts with NALCN or related channels

  • Regulatory mechanisms of the NALCN-FAM155A complex:

    • Explore how post-translational modifications affect complex assembly and function

    • Investigate potential regulation by G protein-coupled receptors

    • Study the role of the non-coding RNA FAM155A-IT1 in regulating expression

  • Development of specific pharmacological tools:

    • Design compounds that specifically target the NALCN-FAM155A interface

    • Create tools to selectively modulate the sodium leak current

  • Role in disease models:

    • Generate and characterize FAM155A knockout or mutant animal models

    • Investigate the role of FAM155A in neurodevelopmental disorders

    • Study potential connections to neurodegenerative diseases

How might advanced technologies enhance FAM155A research in the coming years?

Several emerging technologies hold promise for advancing FAM155A research:

  • Cryo-electron tomography:

    • Visualize the NALCN-FAM155A complex in its native cellular environment

    • Study structural changes associated with channel gating or modulation

  • Single-molecule FRET:

    • Monitor dynamic conformational changes during channel gating

    • Study the kinetics of complex assembly

  • Advanced electrophysiological approaches:

    • Automated patch-clamp for high-throughput screening of mutations or compounds

    • Combined voltage-clamp fluorometry to correlate structural changes with function

  • CRISPR-based approaches:

    • Generate precise knock-in models with patient-specific mutations

    • Create cell type-specific conditional knockouts to study tissue-specific functions

  • Computational approaches:

    • Molecular dynamics simulations to understand channel gating

    • Virtual screening for compounds targeting the FAM155A-NALCN interface

    • AI-driven prediction of mutation effects on complex formation and function

These advanced technologies will enable researchers to address fundamental questions about FAM155A function and potentially develop therapeutic approaches targeting the NALCN channelosome.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.