Recombinant Bovine Transmembrane protein with metallophosphoesterase domain (TMPPE)

Shipped with Ice Packs
In Stock

Description

Production Methods

Recombinant TMPPE is produced using two primary approaches:

  1. Transgenic Bovine Systems: Early patents describe methods for generating transgenic cattle capable of producing recombinant polypeptides, including TMPPE, in milk or other tissues .

  2. Escherichia coli Expression: Commercial production often utilizes E. coli systems, yielding purified protein with optimized bioactivity .

Predicted Interaction Partners

STRING-db analysis of human TMPPE homologs identifies interaction partners, which may inform bovine TMPPE’s functional network :

Partner ProteinFunction
SLC66A3Solute carrier involved in transmembrane transport
TMEM41ARegulates lipid droplet formation and autophagosome biogenesis
UNC50Facilitates cell surface expression of neuronal nicotinic receptors

These interactions suggest roles in transmembrane signaling and cellular homeostasis.

Gene-Chemical Interactions

Studies in mice and humans highlight TMPPE’s responsiveness to environmental factors :

  • Ethanol: Upregulates TMPPE expression.

  • Bisphenol A and Doxorubicin: Downregulate TMPPE expression.

Role in Inflammatory Response

A 2016 study compared wild-type and mutant lipopolysaccharide-binding protein (LBP) effects on bovine mammary epithelial cells (BMECs). While focused on LBP, microarray analysis identified TMPPE as a differentially expressed gene in LPS-induced inflammation. Key findings :

  • 2306 genes showed altered expression in mutant LBP-treated BMECs versus LPS-only cells.

  • 1585 genes were differentially expressed in wild LBP-treated cells.

  • Pathways: TMPPE-associated genes implicated in immune regulation and cell apoptosis, suggesting a potential role in modulating inflammatory responses.

Genetic Association Studies

A 2012 PLOS Genetics study on bovine meiotic recombination identified TMPPE as part of gene networks influencing reproductive traits. Although not a primary focus, its inclusion in genome-wide analyses highlights potential regulatory roles in genetic recombination or fertility .

Applications and Future Directions

  • Biotechnology: Used in structural studies of metallophosphoesterases and transmembrane signaling mechanisms.

  • Agriculture: Potential biomarker for inflammation or fertility traits in cattle.

  • Pharmaceuticals: Target for modulating immune responses in bovine mastitis or other inflammatory diseases.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TMPPE; Transmembrane protein with metallophosphoesterase domain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
TMPPE
Target Protein Sequence
MAIFRQLSLGAKAALAAGTVFVSMIVSRSYLAESLEFRAWRCLFRLQLALFVNSLMLLGS IYIWRSTVSNLRHSPAAESACFQLWKMVVAAFLALAHSSFFTMIFLVAEEPYLFSLVAYT CLGAYVIMLCFLCVLSGMEQAYQLLAWRAGRAVGSLDKTRKLALRPALAVMVTTVLSVVG LLNAAQPPAVTTVEVPVHRLPPSMNSLKIVLLSDIHLGPTVGRTKMDMFVRMVNTLEPDV TVIVGDLCDSEASVLRTAVAPLGQLRSRLGTYFVTGNHEYYTSDVSNWFALLMSLNVQPL HNENVRISATGAHREDDDWICLAGVDDIEANILHYTGHGMDLEKALEGCSPDHPTILLAH QPLAAKRALQARPDINLILSGHTHAGQIFPLNVAAYLLNPFFAGLYQVAETTFVYVSPGT AYYGIPMRLGSRAEITQLILQAAP
Uniprot No.

Target Background

Database Links

KEGG: bta:527730

UniGene: Bt.102850

Protein Families
Metallophosphoesterase superfamily, LOC643853 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMPPE and what is its functional role in bovine cellular biology?

TMPPE (Transmembrane protein with metallophosphoesterase domain) is an integral membrane protein containing a metallophosphoesterase catalytic domain . While specific bovine TMPPE functions remain under investigation, its structural characteristics suggest roles in phosphate ester hydrolysis reactions, potentially participating in cellular signaling pathways or phospholipid metabolism.

To investigate TMPPE function, researchers should:

  • Extract the protein using membrane protein isolation protocols with non-ionic detergents

  • Employ affinity purification utilizing the recombinant protein's tag

  • Conduct phosphatase activity assays using general substrates like p-nitrophenyl phosphate

  • Compare activity in different tissue extracts to identify tissue-specific functions

What methods are recommended for detecting native bovine TMPPE expression?

Detection of bovine TMPPE requires careful selection of antibodies and techniques:

  • Western blotting: Use TMPPE-specific antibodies at 0.4 μg/ml concentration

  • Immunohistochemistry: Apply antibodies at 1:50-1:200 dilution for tissue section analysis

  • Immunofluorescence: Implement at 1-4 μg/ml for cellular localization studies

For optimal results:

  • Include positive controls from tissues with known TMPPE expression

  • Validate specificity through pre-adsorption with recombinant protein

  • Compare results using multiple antibodies recognizing different epitopes

  • Consider species cross-reactivity when using commercially available antibodies

How should researchers approach TMPPE protein structure analysis?

TMPPE structure analysis should proceed through multiple complementary approaches:

  • In silico prediction:

    • Transmembrane domain prediction using TMHMM

    • Metallophosphoesterase domain identification using Pfam

    • Homology modeling based on related metallophosphoesterases

  • Experimental verification:

    • Limited proteolysis to identify domain boundaries

    • Circular dichroism spectroscopy for secondary structure assessment

    • Cysteine accessibility methods to map transmembrane segments

  • Structural biology approaches:

    • X-ray crystallography of purified recombinant protein

    • Cryo-EM for membrane-embedded protein

    • NMR for soluble domain characterization

What expression systems are optimal for producing functional recombinant bovine TMPPE?

Expression of functional recombinant bovine TMPPE presents significant challenges due to its transmembrane nature. Based on comprehensive analysis of membrane protein expression systems:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliHigh yield, Low cost, Rapid expressionLimited post-translational modifications, Inclusion body formationUse C41(DE3) or C43(DE3) strains, Fusion tags (MBP), Lower induction temperature (16-20°C)
Yeast (P. pastoris)Eukaryotic PTMs, High density cultureGlycosylation pattern differs from mammalianMethanol induction optimization, Codon optimization for yeast expression
Insect cellsMammalian-like PTMs, Good for membrane proteinsMore complex, Higher costOptimize MOI, Harvest timing, Consider stable cell lines
Mammalian cellsNative-like environment, Authentic PTMsLowest yield, Highest costTransient vs. stable expression, Optimize transfection reagents

For recombinant bovine TMPPE, insect cell expression often provides the best balance between protein quality and yield, offering appropriate post-translational modifications while maintaining reasonable expression levels.

How does metal coordination affect TMPPE catalytic activity?

As a metallophosphoesterase, TMPPE activity depends critically on metal coordination:

  • Metal identification protocol:

    • Express and purify TMPPE in metal-depleted conditions

    • Reconstitute with individual metals (Mn²⁺, Mg²⁺, Zn²⁺, Fe²⁺, Co²⁺)

    • Determine activity restoration using phosphatase assays

    • Confirm metal binding using isothermal titration calorimetry

  • Metal-binding site characterization:

    • Mutate predicted metal-coordinating residues (typically His, Asp, Glu)

    • Assess impact on metal binding and catalytic activity

    • Create structural models of metal coordination sphere

  • Physiological relevance assessment:

    • Compare activity across physiologically relevant metal concentrations

    • Investigate potential regulatory roles of metal switching

The metallophosphoesterase domain likely coordinates 1-2 metal ions that activate water molecules for nucleophilic attack on phosphate ester bonds, similar to other enzymes in this family.

What approaches can determine TMPPE substrate specificity?

Determining TMPPE substrate specificity requires systematic screening of potential substrates combined with kinetic analysis:

  • Substrate screen methodology:

    • Test generic phosphatase substrates (pNPP, DiFMUP)

    • Examine phosphorylated biomolecules (nucleotides, phosphopeptides, phospholipids)

    • Screen tissue extracts for natural substrates using activity-based approaches

  • Kinetic parameter determination:

    • Measure reaction rates across substrate concentration range

    • Calculate Km, kcat, and catalytic efficiency (kcat/Km)

    • Compare parameters across different substrate classes

  • Structural basis investigation:

    • Perform molecular docking with candidate substrates

    • Identify substrate-binding residues through mutagenesis

    • Co-crystallize with substrate analogs or inhibitors

This comprehensive approach will reveal whether TMPPE has narrow or broad substrate specificity and provide insights into its physiological function.

What antibodies and immunological tools are available for TMPPE research?

For TMPPE detection and characterization, researchers can utilize:

  • Commercial antibodies: Novus Biologicals NBP1-93749-25ul rabbit polyclonal antibody is validated for Western blot (0.4 μg/ml), immunohistochemistry (1:50-1:200), and immunocytochemistry/immunofluorescence (1-4 μg/ml)

  • Epitope information: This antibody was developed against a specific recombinant protein fragment with the sequence: WFALLESLHVQPLHNENVKISATRAQRGGGGSGSGSEDEDWICLAGVDDIEADILHYSGHGMDLDKALEGCSPDHTIILLAHQPLAAKRALQARPDINLILSGHTHAGQIF

  • Validation: Specificity verified on a protein array containing target protein plus 383 other non-specific proteins

When using these tools:

  • Verify cross-reactivity with bovine TMPPE through sequence alignment

  • Include appropriate controls (blocking peptide, TMPPE-depleted samples)

  • Optimize conditions for each application (fixation, blocking, antibody concentration)

  • Consider generating bovine-specific antibodies if cross-reactivity is insufficient

How should researchers design site-directed mutagenesis studies for TMPPE?

Site-directed mutagenesis provides powerful insights into TMPPE structure-function relationships:

  • Priority targets for mutagenesis:

    • Conserved metallophosphoesterase motifs (identified through sequence alignment)

    • Predicted metal-binding residues (typically His, Asp, Glu)

    • Transmembrane domain residues that may affect membrane integration

    • Potential catalytic residues based on homology to related enzymes

  • Mutagenesis strategy:

    • Alanine scanning to identify functionally important residues

    • Conservative substitutions (Asp→Glu) to test specific chemical properties

    • Charge reversal mutations to probe electrostatic interactions

    • Cysteine substitutions for accessibility studies

  • Functional assessment of mutants:

    • Express mutants alongside wild-type controls

    • Verify protein expression and folding

    • Compare catalytic parameters (Km, kcat)

    • Assess membrane integration and localization

  • Data interpretation framework:

    • Map mutations onto structural models

    • Categorize mutations by phenotype (inactive, reduced activity, enhanced activity)

    • Correlate functional defects with structural perturbations

What protocols should be used to assess TMPPE phosphatase activity?

For rigorous characterization of TMPPE phosphatase activity:

  • Standard phosphatase assay protocol:

    • Buffer: 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM divalent metal ion

    • Substrate: p-nitrophenyl phosphate (1-10 mM)

    • Enzyme: 0.1-1 μg purified recombinant TMPPE

    • Incubation: 30 minutes at 37°C

    • Detection: Absorbance at 405 nm following reaction termination with NaOH

    • Controls: Heat-inactivated enzyme, no-enzyme reaction

  • Kinetic parameter determination:

    • Vary substrate concentration (0.1-10× Km)

    • Measure initial reaction velocities

    • Fit data to Michaelis-Menten equation

    • Calculate Km, Vmax, and kcat

  • Metal dependence characterization:

    • Test activity with different metal cofactors (Mn²⁺, Mg²⁺, Zn²⁺, Fe²⁺)

    • Include metal chelation controls (EDTA, EGTA)

    • Determine optimal metal:enzyme ratio

  • Inhibitor profiling:

    • Test general phosphatase inhibitors (vanadate, molybdate)

    • Screen for specific inhibitors through small molecule libraries

    • Determine inhibition constants and mechanisms

How can researchers reconcile conflicting data in TMPPE studies?

When confronted with contradictory findings regarding TMPPE function or properties:

  • Methodological comparison:

    • Create a comprehensive table detailing experimental conditions across studies

    • Identify variables that might explain discrepancies (pH, temperature, detergents)

    • Assess protein preparation methods (tags, purification strategies)

    • Compare assay sensitivities and detection limits

  • Statistical re-evaluation:

    • Implement meta-analysis approaches when possible

    • Reassess statistical power in relation to observed effect sizes

    • Consider Bayesian analysis to incorporate prior knowledge

    • Apply more stringent significance thresholds for conflicting results

  • Integrative approaches:

    • Design experiments specifically addressing contradictions

    • Use orthogonal methods to verify key findings

    • Evaluate context-dependence of conflicting observations

    • Consider species differences when comparing studies

What bioinformatic tools are most effective for analyzing TMPPE evolutionary conservation?

Evolutionary analysis provides valuable context for TMPPE research:

  • Sequence analysis pipeline:

    • Identify orthologs using reciprocal BLAST

    • Generate multiple sequence alignments using MUSCLE or MAFFT

    • Calculate conservation scores using ConSurf or similar tools

    • Visualize conservation on structural models

  • Phylogenetic analysis approach:

    • Select appropriate evolutionary models (JTT, WAG)

    • Construct trees using maximum likelihood or Bayesian methods

    • Calculate bootstrap support for key branches

    • Map functional divergence onto phylogeny

  • Selection analysis:

    • Calculate dN/dS ratios to identify selection pressure

    • Perform branch-site tests for lineage-specific selection

    • Identify sites under positive or negative selection

    • Correlate selection patterns with functional domains

These analyses can reveal functionally important regions and guide experimental design by highlighting conserved catalytic residues versus variable regulatory regions.

How should researchers approach statistical analysis of TMPPE expression data?

For robust statistical analysis of TMPPE expression across tissues or conditions:

  • Recommended statistical workflow:

    • Assess data normality using Shapiro-Wilk test

    • Apply appropriate transformations if needed (log, square root)

    • Use ANOVA with post-hoc tests for multi-group comparisons

    • Implement non-parametric tests (Kruskal-Wallis) for non-normal data

    • Apply false discovery rate correction for multiple comparisons

  • Sample size considerations:

    • Conduct power analysis before experiments

    • For typical expression studies, include minimum 3-5 biological replicates

    • Report both statistical significance and effect sizes

    • Consider variability when determining sample sizes

  • Advanced analytical approaches:

    • Use linear mixed models for complex experimental designs

    • Apply principal component analysis to identify patterns

    • Implement hierarchical clustering for tissue expression profiling

    • Consider Bayesian approaches for small sample sizes

What are the most promising approaches for determining TMPPE physiological function?

To elucidate TMPPE's physiological role:

  • Genetic modification strategies:

    • CRISPR/Cas9 knockout in cell lines and animal models

    • Conditional knockout to avoid developmental effects

    • Knock-in of catalytically inactive mutants

    • Tagged endogenous protein for interactome studies

  • Physiological substrate identification:

    • Phosphoproteomic analysis comparing wild-type and TMPPE-deficient samples

    • Proximity labeling to identify interacting proteins

    • Metabolomic profiling to detect changes in phosphorylated metabolites

    • In vitro screening with physiological substrate candidates

  • Systems biology integration:

    • Transcriptomic analysis of TMPPE-deficient models

    • Network analysis to position TMPPE in signaling pathways

    • Correlation with physiological processes across tissues

These complementary approaches will provide convergent evidence for TMPPE's true biological function.

How can structural biology techniques be optimized for TMPPE characterization?

Structural characterization of membrane proteins like TMPPE presents unique challenges:

  • Sample preparation optimization:

    • Screen detergents systematically (DDM, LMNG, GDN)

    • Test alternative membrane mimetics (nanodiscs, SMALPs, amphipols)

    • Identify stabilizing conditions (ligands, lipids, metal ions)

    • Consider protein engineering to enhance stability

  • Complementary structural approaches:

    • X-ray crystallography for high-resolution structures

    • Cryo-EM for membrane-embedded protein

    • SAXS for solution conformation

    • HDX-MS for conformational dynamics

  • Integration with computational methods:

    • Molecular dynamics simulations in membrane environments

    • Homology modeling based on related metallophosphoesterases

    • In silico docking for substrate and inhibitor binding

Structural insights will accelerate functional understanding by revealing catalytic mechanisms and substrate recognition features.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.