Recombinant Bovine Tumor protein p53-inducible protein 11 (TP53I11)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Bovine TP53I11

TP53I11 is a tumor suppressor gene product transcriptionally regulated by p53. The recombinant bovine form is synthesized using heterologous expression systems to enable biochemical and functional studies. Key characteristics include:

  • Molecular Weight: ~21 kDa (human homolog) .

  • Structure: Contains 177 amino acids with redox-regulating domains implicated in apoptosis .

  • Function: Modulates endoplasmic reticulum (ER) calcium (Ca²⁺) levels, AMPK activation, and cancer cell proliferation .

Production Systems and Applications

Recombinant bovine TP53I11 is produced in multiple platforms to meet research demands.

Expression SystemTagPurityApplicationsSource
E. coliHis, GST>90%Structural studies, antibody production
HEK293 cellsDDK, Myc, Fc>95%Functional assays, cell signaling studies
Mammalian cellsNative>85%In vivo tumor models, drug screening

These systems ensure high yield and post-translational modifications critical for functional studies .

ER Calcium Regulation

TP53I11 elevates basal ER Ca²⁺ levels by inhibiting leak channels, which is critical for:

  • Inducing apoptosis in cancer cells under metabolic stress .

  • Enhancing chemotherapeutic efficacy (e.g., doxorubicin) by promoting Ca²⁺ accumulation .

Key Finding: Overexpression of TP53I11 in HeLa cells increases ER Ca²⁺ by 40% and reduces proliferation by 25% .

AMPK and Metabolic Flexibility

TP53I11 suppresses AMPK activation under glucose starvation, limiting cancer cell survival:

  • Knockdown: Increases AMPK activity by 2-fold, enhancing anoikis resistance .

  • Overexpression: Reduces tumor growth in xenograft models by 60% .

Anti-Tumor Effects

  • Breast Cancer: TP53I11 suppresses extracellular matrix (ECM)-independent survival and metastasis in MDA-MB-231 cells by inhibiting AMPK and EMT markers (e.g., CDH2, VIM) .

  • Chemotherapy Synergy: Doxorubicin upregulates TP53I11, amplifying ER Ca²⁺ overload and apoptosis .

In Vivo Efficacy

ModelInterventionOutcomeSource
Nude mice (orthotopic)TP53I11 overexpression50% reduction in tumor volume and lung metastases
HeLa xenograftsTP53I11 + doxorubicin70% increase in caspase-3 activation

Future Directions

Current gaps include structural resolution of bovine TP53I11 and species-specific functional validation. Targeting TP53I11-mediated Ca²⁺ signaling could optimize chemotherapeutic regimens .

Product Specs

Form
Lyophilized powder
Please note that we prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
As a standard practice, all our proteins are shipped with blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we suggest briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Repeated freeze-thaw cycles should be avoided.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us. We will prioritize development with the specified tag if possible.
Synonyms
TP53I11; PIG11; Tumor protein p53-inducible protein 11; p53-induced gene 11 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
TP53I11
Target Protein Sequence
MAAKQPPPLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFAVREPL GLRVWQFVSAVLFSGIAIMALAFPDQLYDAVFDGAQVTSKTPIRLYGGALLSISLIMWNA LYTAEKVIIRWTLLTEACYFSVQFLVVTATLAETGLASQGILLLLASRLLFVAISVYYYY QVGRKPKKV
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TP53I11 and what is its relationship to the p53 pathway?

TP53I11 (Tumor protein 53-inducible protein 11) was first identified approximately two decades ago as one of the early transcriptional targets of the tumor suppressor protein p53 . It belongs to the broader network of p53-regulated genes that collectively mediate tumor suppression. While p53 functions primarily as a transcription factor that activates numerous target genes involved in cell cycle arrest, DNA repair, apoptosis, and metabolism, TP53I11 specifically appears to function as a metabolic mediator within this network .

The relationship between TP53I11 and p53 is hierarchical: p53 directly activates TP53I11 transcription as part of its stress response cascade. This activation typically occurs following DNA damage or other cellular stresses that trigger p53 stabilization. Unlike some p53 targets that are universally expressed following p53 activation, TP53I11 expression patterns suggest tissue-specific and context-dependent regulation, particularly in epithelial cells .

Methodologically, researchers investigating this relationship should employ chromatin immunoprecipitation (ChIP) assays to confirm direct p53 binding to the TP53I11 promoter, coupled with luciferase reporter assays to quantify transcriptional activation under various stress conditions.

What experimental systems are most effective for studying recombinant bovine TP53I11?

When investigating recombinant bovine TP53I11, researchers should consider multiple experimental systems that complement each other:

Cell culture systems:

  • Established mammary epithelial cell lines (MCF10A for non-transformed studies)

  • Breast cancer cell lines (MDA-MB-231 for malignant phenotype studies)

  • HEK293 and HeLa cells for calcium homeostasis studies

Three-dimensional culture systems:

  • Matrigel cultures for studying invasive growth and morphogenesis

  • Spheroid formation assays to assess ECM-independent survival

Animal models:

  • Orthotopic xenograft models (mammary fat pad injection)

  • Tail-vein injection models for metastasis studies

The choice between these systems should be guided by specific research questions. For studying basic TP53I11 function, cell culture systems provide controlled environments. For investigating metastatic potential and in vivo relevance, animal models are essential. When producing recombinant bovine TP53I11, bacterial expression systems (E. coli) may be used for protein production, followed by purification via affinity chromatography and validation through Western blotting and functional assays.

How can researchers effectively validate TP53I11 knockout or overexpression models?

Validation of genetic manipulation of TP53I11 requires a multi-level approach:

Molecular validation:

  • RT-qPCR to confirm changes in mRNA expression

  • Western blotting to verify protein levels using specific antibodies

  • Sequencing to confirm genetic modifications in CRISPR/Cas9 systems

Functional validation:

  • Calcium imaging using fluorescent sensors (e.g., TuNer-s) to measure ER Ca²⁺ levels

  • Cell proliferation assays (e.g., PCNA expression, viability assays)

  • Cell cycle analysis using flow cytometry

Phenotypic validation:

  • Spheroid formation assays in detached culture

  • Invasion assays in Matrigel

  • Anoikis resistance measurements

Table 1: Recommended Validation Methods for TP53I11 Genetic Manipulation

Validation LevelMethodExpected Result in KnockoutExpected Result in Overexpression
MolecularRT-qPCRDecreased or absent TP53I11 mRNAIncreased TP53I11 mRNA
MolecularWestern blotDecreased or absent TP53I11 proteinIncreased TP53I11 protein
FunctionalER Ca²⁺ imagingDecreased ER Ca²⁺ levelsIncreased ER Ca²⁺ levels
FunctionalCell proliferationVariable (context-dependent)Enhanced in normal culture, reduced under stress
PhenotypicSpheroid assayIncreased size and numberDecreased size and number
PhenotypicAnoikis assayReduced cell death in suspensionIncreased cell death in suspension

All validation experiments should include appropriate controls (scrambled siRNA, empty vector transfections) and be performed in at least three independent biological replicates to ensure reproducibility.

How does TP53I11 regulate metabolic flexibility in cancer cells?

TP53I11 appears to play a crucial role in metabolic regulation, particularly at the interface between glycolysis and oxidative phosphorylation (OXPHOS). Research indicates that TP53I11 exerts context-dependent effects on cellular metabolism, which may explain its seemingly paradoxical roles in different cellular conditions:

In normal culture conditions:

  • TP53I11 enhances aerobic glycolysis (Warburg effect)

  • Promotes proliferation through increased metabolic flux

  • Increases PCNA expression and cell viability

Under stress conditions (ECM detachment, glucose starvation):

  • TP53I11 suppresses AMPK activation

  • Reduces metabolic flexibility

  • Decreases cell survival capacity

This metabolic regulation appears central to TP53I11's tumor suppressive functions. The protein may act as a "metabolic checkpoint" that favors proliferation under optimal conditions but prevents survival adaptation under stressful conditions that cancer cells typically encounter during metastasis.

Methodologically, researchers investigating this phenomenon should employ:

  • Seahorse XF analyzers to measure oxygen consumption rate (OCR) and extracellular acidification rate (ECAR)

  • Glucose uptake assays using labeled glucose

  • Lactate production measurements

  • Western blotting for key metabolic enzymes and AMPK phosphorylation status

  • Metabolomic profiling to identify shifts in metabolic pathways

These approaches should be performed in both normal and stress conditions (glucose starvation, matrix detachment) to fully capture TP53I11's context-dependent metabolic effects.

What mechanisms underlie TP53I11's regulation of calcium homeostasis?

TP53I11 has emerged as a key regulator of endoplasmic reticulum (ER) calcium homeostasis, with significant implications for cell survival and cancer progression. The molecular mechanisms appear to involve:

Direct effects on calcium handling proteins:

  • TP53I11 knockdown significantly reduces the TuNer-s ratio (an indicator of ER Ca²⁺ levels) in both HEK293 and HeLa cells

  • Overexpression of TP53I11 increases basal ER Ca²⁺ levels

Responsiveness to chemotherapeutic agents:

  • Doxorubicin (DOX) treatment upregulates TP53I11 expression

  • This upregulation enhances ER Ca²⁺ accumulation

The connection between TP53I11, calcium homeostasis, and cell death pathways represents a promising area for cancer research. Alterations in ER calcium can trigger various cell death mechanisms, including apoptosis and autophagy, potentially explaining part of TP53I11's tumor suppressive function.

To investigate these mechanisms, researchers should employ:

  • Real-time calcium imaging using fluorescent indicators like TuNer-s

  • Patch-clamp electrophysiology to measure calcium currents

  • Immunoprecipitation to identify TP53I11 interactions with calcium channels or pumps

  • Pharmacological inhibitors of specific calcium channels to dissect the pathway

  • Subcellular fractionation to determine TP53I11's localization relative to calcium handling machinery

How does TP53I11 contribute to the epithelial-mesenchymal transition (EMT) and metastasis?

TP53I11 appears to function as a metastasis suppressor through its effects on epithelial-mesenchymal transition (EMT), a critical process in cancer progression. Research findings indicate:

Effects on EMT markers and phenotype:

  • TP53I11 overexpression reduces expression of mesenchymal markers (CDH2, VIM)

  • Loss of TP53I11 promotes invasive growth in Matrigel

  • TP53I11 overexpression significantly reduces local invasion and metastatic burden in animal models

In vivo evidence:

  • In orthotopic xenograft models, TP53I11 overexpression reduces tumor growth

  • In tail-vein injection models, TP53I11 overexpression decreases lung metastasis

  • Histological analysis shows smaller viable tumor rims in TP53I11-overexpressing tumors

Proposed mechanisms:

  • Suppression of ECM-independent survival capacity

  • Reduction in metabolic flexibility required for metastatic progression

  • Inhibition of AMPK activation under stress conditions

Table 2: TP53I11 Effects on Metastasis-Related Parameters in MDA-MB-231 Cells

ParameterEffect of TP53I11 OverexpressionEffect of TP53I11 KnockdownMethodology
Cell MigrationDecreasedIncreasedWound healing assay
InvasionReduced branching structures in MatrigelEnhanced invasive growth3D Matrigel culture
EMT MarkersReduced CDH2 and VIM expressionIncreased mesenchymal markersWestern blot, IHC
Tumor GrowthReduced tumor volume and weightEnhanced tumor growthOrthotopic xenograft
Lung MetastasisReduced number and size of coloniesIncreased metastatic burdenTail-vein injection model
Local InvasionSuppressedEnhancedH&E staining of primary tumors

Researchers investigating these mechanisms should utilize a combination of in vitro and in vivo approaches, including migration/invasion assays, EMT marker analysis, and animal models of metastasis with appropriate controls and quantification methods.

What role does TP53I11 play in AMPK signaling under metabolic stress conditions?

The relationship between TP53I11 and AMP-activated protein kinase (AMPK) signaling represents a critical aspect of its function in metabolic stress adaptation:

Key observations:

  • Loss of TP53I11 increases AMPK activation in detached MCF10A and MDA-MB-231 cells

  • Under glucose starvation, TP53I11 overexpression reduces AMPK activation

  • TP53I11 knockdown enhances AMPK activation under stress conditions

Functional consequences:

  • AMPK activation promotes survival under stress conditions by preserving energy homeostasis

  • By suppressing AMPK activation, TP53I11 reduces cellular capacity to adapt to metabolic stresses

  • This mechanism may explain how TP53I11 prevents survival of cancer cells during ECM detachment and nutrient deprivation

AMPK functions as a master regulator of metabolic flexibility, allowing cells to cope with energetic challenges. TP53I11 appears to restrict this flexibility, potentially as part of p53's tumor suppressor program to prevent survival of cells under abnormal growth conditions.

To study this relationship, researchers should:

  • Measure AMPK phosphorylation (Thr172) by Western blotting under various stress conditions

  • Use AMPK inhibitors (e.g., Compound C) to determine if they recapitulate TP53I11 overexpression effects

  • Employ AMPK activators (e.g., AICAR) to test if they rescue phenotypes in TP53I11-overexpressing cells

  • Analyze downstream AMPK targets (ACC, ULK1) to confirm pathway modulation

  • Perform metabolic profiling to identify shifts in energy-generating pathways

How can researchers effectively manipulate TP53I11 expression for experimental purposes?

Researchers have several options for manipulating TP53I11 expression, each with specific advantages and considerations:

Knockdown approaches:

  • siRNA transfection: Provides transient knockdown suitable for short-term experiments

  • shRNA expression: Enables stable knockdown through viral delivery systems

  • CRISPR/Cas9: Allows complete knockout through genomic editing

Overexpression strategies:

  • Plasmid-based transient transfection

  • Viral vectors for stable integration

  • Inducible expression systems for temporal control

Pharmacological modulation:

  • Doxorubicin treatment upregulates TP53I11 expression

  • p53 activators may indirectly increase TP53I11 levels

Table 3: Comparison of TP53I11 Manipulation Strategies

MethodAdvantagesLimitationsValidation Approach
siRNARapid, simple, widely accessibleTransient, variable efficiencyqRT-PCR, Western blot
shRNAStable knockdown, selection possibleRequires viral work, off-target effectsqRT-PCR, Western blot, functional assays
CRISPR/Cas9Complete knockout, stableComplex design, potential compensationSequencing, Western blot, functional assays
Plasmid overexpressionQuick, high expression levelsTransient, potential toxicityWestern blot, subcellular localization
Viral overexpressionStable expression, titratableRequires viral facilities, insertional mutagenesisWestern blot, functional assays
Inducible systemsTemporal control, physiological levelsComplex setup, leakinessWestern blot with/without inducer, time course
DoxorubicinPhysiological inductionPleiotropic effectsWestern blot, qRT-PCR with dose response

When manipulating TP53I11, researchers should carefully consider:

  • Use of appropriate controls (empty vectors, scrambled siRNAs)

  • Cell type-specific optimization of transfection conditions

  • Confirmation of manipulation through multiple validation methods

  • Assessment of off-target effects

  • Rescue experiments to confirm specificity of observed phenotypes

What are the technical challenges in producing recombinant bovine TP53I11 for research applications?

Production of recombinant bovine TP53I11 presents several technical challenges that researchers must address:

Expression system selection:

  • Bacterial systems (E. coli): Simple and cost-effective but may lack post-translational modifications

  • Mammalian expression systems: Better for maintaining native protein folding and modifications

  • Insect cell systems (baculovirus): Balance between yield and proper folding

Protein solubility and stability:

  • TP53I11 may form inclusion bodies in bacterial systems

  • Optimization of culture conditions (temperature, induction time) is critical

  • Addition of solubility tags (MBP, SUMO, GST) may improve recovery

Purification challenges:

  • Selection of appropriate affinity tags that don't interfere with function

  • Development of purification protocols that maintain protein activity

  • Removal of endotoxins for cellular applications

Functional validation:

  • Confirmation that recombinant protein retains native activity

  • Development of functional assays specific to TP53I11

  • Assessment of protein stability under storage conditions

Researchers should conduct pilot expressions in multiple systems, optimize purification conditions through systematic testing, and validate recombinant protein function through comparison with endogenous TP53I11 in cellular assays.

How does TP53I11 function differ between normal and cancer cells?

TP53I11 exhibits context-dependent functions that differ significantly between normal and cancer cells:

In normal epithelial cells:

  • Enhances aerobic glycolysis and proliferation under normal growth conditions

  • Maintains appropriate cellular response to stress signals

  • Promotes cell death under inappropriate growth conditions (e.g., ECM detachment)

In cancer cells:

  • Suppresses tumor progression and metastasis

  • Reduces invasive growth in 3D matrices

  • Inhibits EMT and cell migration

  • Promotes apoptosis under stress conditions

These divergent functions highlight TP53I11's role as a contextual regulator of cell fate. In normal cells, it supports proper growth while preventing survival under abnormal conditions. In cancer cells, it acts primarily as a tumor suppressor by restricting adaptability to stressful microenvironments.

The molecular basis for these differences may involve:

  • Altered interaction partners in cancer cells

  • Different post-translational modifications

  • Varied subcellular localization

  • Cancer-specific metabolic dependencies

Researchers should investigate these differences using isogenic cell line pairs, comparing normal epithelial cells with their transformed counterparts, and examining TP53I11 function in patient-derived samples representing different stages of cancer progression.

What is the relationship between TP53I11 and chemotherapeutic drug responses?

Evidence suggests that TP53I11 may play a significant role in chemotherapeutic responses, particularly through calcium homeostasis mechanisms:

Doxorubicin effects:

  • Doxorubicin treatment upregulates TP53I11 expression

  • This upregulation enhances ER Ca²⁺ accumulation

  • The increase in ER Ca²⁺ may contribute to the cytotoxic effects of doxorubicin

Potential therapeutic implications:

  • TP53I11 status might predict responsiveness to certain chemotherapies

  • Targeting TP53I11-regulated pathways could enhance treatment efficacy

  • Combination approaches targeting both TP53I11 and calcium signaling may provide synergistic effects

To investigate these relationships, researchers should:

  • Perform drug sensitivity assays in TP53I11-manipulated cell lines

  • Analyze TP53I11 expression in patient samples before and after chemotherapy

  • Investigate calcium signaling changes in response to various chemotherapeutic agents

  • Develop combination approaches targeting both TP53I11 and calcium pathways

  • Conduct high-throughput screens to identify compounds that modulate TP53I11 activity or expression

Table 4: Proposed Experimental Design for Investigating TP53I11 in Chemotherapeutic Responses

Experimental ApproachKey MeasurementsExpected OutcomesApplications
Drug sensitivity assaysIC50 values in TP53I11 knockdown/overexpression cellsAltered sensitivity to select compoundsBiomarker development
Patient sample analysisTP53I11 expression pre/post treatmentCorrelation with treatment outcomesPredictive biomarker
Calcium imagingER Ca²⁺ levels with drug treatmentMechanistic understanding of drug actionTarget identification
Combination therapyCell viability, apoptosis markersSynergistic effects with calcium modulatorsNovel treatment strategies
High-throughput screeningTP53I11 expression/activity modulatorsDiscovery of novel compoundsDrug development

What are promising approaches for studying TP53I11 interactions with the tumor microenvironment?

The interaction between TP53I11 and the tumor microenvironment represents an underexplored area with significant potential:

Key research questions:

  • How does TP53I11 affect cancer cell interactions with stromal cells?

  • Does TP53I11 influence angiogenesis or immune cell recruitment?

  • Can TP53I11 status in cancer cells alter extracellular matrix composition?

Recommended methodological approaches:

  • Co-culture systems with cancer cells and stromal components

  • 3D organoid models incorporating multiple cell types

  • In vivo models with fluorescently labeled cell populations

  • Analysis of secreted factors in TP53I11-manipulated cells

  • Immune cell infiltration studies in TP53I11-modified tumors

This research direction could provide valuable insights into how TP53I11's metabolic and calcium regulatory functions extend beyond cancer cell-autonomous effects to influence the broader tumor ecosystem.

How can single-cell analysis advance our understanding of TP53I11 function in heterogeneous tumor populations?

Single-cell technologies offer powerful approaches to understand TP53I11's role in tumor heterogeneity:

Single-cell RNA sequencing applications:

  • Identifying subpopulations with varied TP53I11 expression

  • Correlating TP53I11 levels with stemness markers

  • Mapping TP53I11-associated gene networks at single-cell resolution

Single-cell protein analysis:

  • Mass cytometry (CyTOF) to measure TP53I11 alongside other proteins

  • Single-cell western blotting for protein-level validation

  • Imaging mass spectrometry for spatial context

Functional single-cell assays:

  • Microfluidic approaches to measure metabolic parameters

  • Single-cell calcium imaging in heterogeneous populations

  • Correlating TP53I11 levels with clonogenic potential

These approaches would help resolve conflicting data on TP53I11 function by accounting for cellular heterogeneity and could identify specific cellular contexts where TP53I11 plays critical roles in tumor biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.