Recombinant Bovine Type-1 angiotensin II receptor (AGTR1)

Shipped with Ice Packs
In Stock

Description

Functional Role

AGTR1 binds angiotensin II (Ang II) to regulate blood pressure, fluid balance, and cellular proliferation . Key mechanisms include:

  • Gq protein coupling: Activates phospholipase C (PLC), increasing intracellular Ca²⁺ and protein kinase C (PKC) activity .

  • Pathway activation: Drives the PI3K/Akt and Ras/MAPK pathways, influencing vascular tone and fibrosis .

In bovine models, AGTR1 is hypothesized to play roles analogous to those in humans, such as modulating aldosterone secretion and renal function .

Recombinant Production and Applications

Recombinant AGTR1 is critical for structural studies, drug discovery, and antibody development. While bovine-specific data are sparse, Table 1 summarizes AGTR1 recombinant proteins across species for reference:

Table 1: Recombinant AGTR1 Constructs Across Species

SpeciesExpression SystemTagApplicationsSource
HumanE. coliGST, HisWB, ELISA, AP
RatE. coliHis, GSTWB, IP, PCA
MouseHEK-293His, StrepWB, ELISA
Meleagris gallopavo (Turkey)E. coliNoneFunctional assays

Bovine AGTR1 would likely follow similar design principles, with codon optimization for heterologous expression and affinity tags (e.g., GST or His) for purification .

Research Findings

Key insights from AGTR1 studies in other species:

  • Renal fibrosis: Macrophage-specific AGTR1 deletion exacerbates fibrosis in murine models by impairing phagocytosis and TGF-β1 signaling .

  • Cancer: AGTR1 overexpression in tumors correlates with angiogenesis and metastasis, making it a therapeutic target .

  • SARS-CoV-2 interaction: Human AGTR1 may internalize SARS-CoV-2 spike protein via ACE2 complexation, suggesting a role in viral entry .

These findings underscore AGTR1’s multifunctionality and potential cross-species relevance.

Antibody and Assay Tools

AGTR1-targeting tools validated in other species include:

  • Polyclonal antibodies: Rabbit anti-AGTR1 (25343-1-AP) detects 50 kDa bands in WB across human, mouse, and rat samples .

  • ELISA kits: Quantify AGTR1 expression in tissue lysates or serum .

Bovine AGTR1 would require species-specific validation due to sequence divergence in extracellular domains.

Knowledge Gaps and Future Directions

Current limitations include:

  • No bovine-specific AGTR1 structures or knockout models.

  • Limited data on interspecies variation in ligand-binding pockets.

Future studies should prioritize bovine AGTR1 cloning, crystallography, and in vivo functional assays to bridge these gaps.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format preferences, please indicate them in your order notes, and we will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
AGTR1; Type-1 angiotensin II receptor; Angiotensin II type-1 receptor; AT1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MILNSSTEDGIKRIQDDCPKAGRHNYIFIMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPTIIHRNVFFIENTNITVC AFHYESQNSTLPVGLGLTKNILGFLFPFLIILTSYTLIWKTLKKAYEIQKNKPRKDDIFK IILAIVLFFFFSWVPHQIFTFMDVLIQLGLIRDCKIEDIVDTAMPITICLAYFNNCLNPL FYGFLGKKFKKYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSENGNSSTKKPAPCIEVE
Uniprot No.

Target Background

Function
Receptor for angiotensin II. It mediates its action by associating with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References Into Functions
  1. These findings indicate that bTREK-1 K(+) channels serve as a crucial control point where ANG II receptor activation is transduced into depolarization-dependent Ca(2+) entry and aldosterone secretion. PMID: 15315905
  2. Angiotensin II (ANGII) inhibits adrenocortical cell KCNK2 in an ATP-dependent, PLC/PKC-independent manner. PMID: 17494631
Database Links

KEGG: bta:281607

STRING: 9913.ENSBTAP00000055053

UniGene: Bt.4539

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Adrenal medulla, cortex and kidney.

Q&A

What is the molecular structure and basic characterization of bovine AGTR1?

Bovine AGTR1 is a seven-transmembrane domain G-protein coupled receptor (GPCR) with 359 amino acids and a predicted molecular weight of approximately 41.1 kDa . It belongs to the family of GPCRs that mediate the effects of Angiotensin II, the major bioactive peptide of the renin-angiotensin system . Human AGTR1 shares high sequence identity with mammalian orthologs (94% with mouse and 95% with rat) , suggesting strong evolutionary conservation of this receptor.

Unlike rodents which express two related genes (AGTR1A and AGTR1B), most species including bovines express a single AGTR1 gene . The receptor couples primarily to G proteins containing alpha q/11 subunits and activates multiple signal transduction pathways including:

  • PLC-IP3-Ca2+ pathway

  • PLC-DAG-PKC pathway

  • MAPK pathway

  • Jak/STAT signaling pathway

How is AGTR1 expression detected in bovine embryonic tissues?

Detection of AGTR1 in bovine embryonic tissues involves complementary approaches for both mRNA and protein analysis:

mRNA Expression Analysis:

  • Total RNA extraction from bovine embryos using specialized kits (e.g., Absolutely RNA Nanoprep Kit)

  • DNase I treatment to eliminate genomic DNA contamination

  • Reverse transcription using temperature-optimized cDNA synthesis kits

  • RT-PCR with primers designed to cross exon-exon boundaries (except for AGTR1, where primers target the coding region localized in one exon)

  • β-Actin (ACTB) serves as a housekeeping gene control

  • PCR conditions: 44 cycles for ACTB and 50 cycles for RAS components including AGTR1

Protein Localization:

  • Immunofluorescence with specific antibodies against AGTR1

  • Confocal microscopy analysis of stained embryos

  • Western blotting for quantitative protein expression analysis

Research has demonstrated that AGTR1 protein is present in the plasma membrane of bovine embryonic cells, with additional localization in granular-like structures in the cytoplasm of trophectoderm cells and inner cell mass, suggesting potential receptor internalization .

What physiological roles does AGTR1 mediate in bovine systems?

AGTR1 mediates most of the physiological actions of Angiotensin II in bovine systems, similar to other mammals. These actions include:

  • Vasoconstriction

  • Aldosterone and vasopressin release

  • Salt and water retention regulation

  • Cell proliferation and migration

  • Sympathetic nervous system stimulation

What are the signaling mechanisms of bovine AGTR1 in embryonic development?

Research on bovine pre-implantation embryos has revealed intriguing insights into AGTR1 signaling during early development:

  • While AGTR1 and AGTR2 proteins are expressed in bovine embryos, there was no detectable expression of angiotensin II precursors (AGT, ACE) or renin (REN) under experimental conditions

  • This suggests that embryos may be responsive to maternally-produced Angiotensin II rather than synthesizing it autonomously

  • The renin-angiotensin system components (REN, AGT, ACE) are present in the maternal endometrium and vary cyclically, potentially providing developmental signals from mother to embryo

Experimental studies using receptor antagonists revealed:

  • AGTR1 blockade with Olmesartan did not significantly affect embryo development parameters

  • In contrast, AGTR2 blockade with PD123319 significantly increased the proportion of hatched embryos

These findings suggest a complex interplay between AGTR1 and AGTR2 in regulating embryo development, with AGTR2 potentially playing a restrictive role in embryo hatching, while AGTR1's precise developmental function requires further investigation .

How does AGTR1 inhibition affect cellular processes beyond cardiovascular regulation?

Recent research has uncovered important non-cardiovascular roles for AGTR1, particularly in cellular growth and senescence:

In hepatocellular carcinoma (HCC) cells, AGTR1 suppression:

  • Dramatically restrained cellular growth

  • Triggered G2-M cell phase arrest

  • Increased expression of senescence markers p53, p-p53, p21, and p-p21

  • Elevated percentages of SA-β-Gal-positive cells (a marker of cellular senescence)

  • Worked through inactivation of ERK signaling

These findings suggest AGTR1 may function as a regulator of cellular senescence, with potential implications for development, aging, and cancer research . The connection between AGTR1 and senescence pathways could provide insights into its role in bovine embryonic development and tissue homeostasis beyond traditional cardiovascular functions.

What structural determinants influence ligand binding and selectivity in bovine AGTR1?

Molecular docking studies have provided insights into the structural basis of AGTR1 ligand binding:

  • The 3D structure of AGTR1 (human model from PDB ID: 4YAY) reveals an asymmetric, monomeric structure with a specific binding pocket for antagonists

  • Key binding pocket residues interact with established AGTR1 inhibitors including candesartan, losartan, and valsartan

  • Virtual screening approaches have identified natural compounds with binding energies comparable to known AGTR1 inhibitors

Promising natural compounds identified through molecular docking include:

  • ZINC85625504

  • ZINC62001623

  • ZINC70666587

  • ZINC06624086

  • ZINC95486187

These compounds interact with crucial AGTR1 residues based on docking simulations, suggesting potential as novel AGTR1 inhibitors for research applications .

What are the optimal techniques for studying AGTR1 expression in bovine embryos?

Based on published research protocols, the following methodologies represent current best practices for AGTR1 expression analysis in bovine embryos:

RNA Extraction and RT-PCR Protocol:

  • Extract total RNA from bovine embryos using Absolutely RNA Nanoprep Kit with DNase I treatment

  • Perform reverse transcription on RNA from approximately 20 embryos

  • Use β-Actin (ACTB) as a housekeeping gene for normalization

  • Design primers for AGTR1 within the coding region (located in one exon)

  • Run PCR with 44 cycles for ACTB and 50 cycles for AGTR1

  • Analyze PCR products on 1.8% agarose gel containing 0.5 μg/ml ethidium bromide

Protein Detection Protocol:

  • Process embryos for immunofluorescence staining with AGTR1-specific antibodies

  • Analyze receptor localization using confocal microscopy

  • Confirm expression patterns across multiple embryonic stages from pre-implantation to hatched blastocyst

This combined approach provides comprehensive characterization of both mRNA expression and protein localization, enabling detailed analysis of spatial and temporal expression patterns during development.

How can researchers effectively investigate AGTR1 function in bovine embryonic development?

To assess AGTR1 function in bovine embryos, researchers can employ the following validated methodological approach:

Pharmacological Intervention Protocol:

  • Culture bovine embryos in standard medium supplemented with:

    • Angiotensin II (agonist)

    • PD123319 (AGTR2 antagonist)

    • Olmesartan (AGTR1 antagonist)

    • Control medium (no supplements)

  • Monitor embryo development parameters including:

    • Oocyte cleavage rates

    • Embryo expansion

    • Hatching rates

  • Statistical analysis:

    • Compare treatment groups using appropriate statistical tests (e.g., one-way ANOVA with Bonferroni post hoc tests)

    • Consider p values < 0.05 as statistically significant

    • Present data as mean ± standard deviation

This approach has successfully demonstrated that AGTR2 blockade significantly improves embryo hatching, while AGTR1 blockade has limited effects on early embryonic development parameters .

What molecular docking approaches are effective for identifying bovine AGTR1 antagonists?

Researchers investigating bovine AGTR1 antagonists can employ the following molecular docking workflow:

Target Protein Preparation:

  • Obtain 3D structure of AGTR1 (e.g., from RCSB PDB, ID: 4YAY)

  • Remove water molecules, heteroatoms, and co-crystallized ligands

  • Clean and process the protein structure before saving as a .pdb file

Virtual Screening Protocol:

  • Prepare a library of compounds (e.g., natural compounds from ZINC database)

  • Filter compounds using Lipinski and Veber Rules for drug-likeness

  • Select compounds with molecular weights in appropriate range (300-500 Da)

  • Set up grid parameters for docking (X=-16.087, Y=9.764, Z=41.290)

  • Perform molecular docking using software like PyRx

  • Analyze results based on binding energies compared to control compounds

  • Visualize docked complexes using DS Visualizer or PyMol

Control Compounds for Comparison:

  • ZD7 (co-crystal ligand)

  • Candesartan

  • Losartan

  • Valsartan

This approach has successfully identified natural compounds with binding energies comparable to established AGTR1 inhibitors, providing valuable starting points for bovine-specific antagonist development .

How does AGTR1 contribute to maternal-embryonic communication in bovine reproduction?

Research suggests that AGTR1 may play a key role in maternal-embryonic signaling during early bovine development:

  • Bovine embryos express AGTR1 and AGTR2 but not the precursors for Angiotensin II production (AGT, REN, ACE)

  • This suggests embryos respond to maternally-produced Angiotensin II rather than producing it autonomously

  • REN, AGT, and ACE are present in the endometrium and vary cyclically, potentially providing developmental signals from mother to embryo

  • Angiotensin II could therefore function as a signaling molecule in maternal-embryonic communication

The differential expression of angiotensin receptors in embryos versus maternal tissues creates a signaling axis that may regulate key developmental processes including implantation and placentation. Further research using co-culture systems of embryos with endometrial cells could elucidate these communication mechanisms in greater detail.

What is the potential for developing bovine-specific AGTR1 antagonists for research applications?

Molecular docking studies have identified promising candidates for bovine-specific AGTR1 antagonists:

Compound IDSourceBinding EnergyKey Interacting Residues
ZINC85625504Natural compoundSimilar to established inhibitorsMultiple AGTR1 active site residues
ZINC62001623Natural compoundSimilar to established inhibitorsMultiple AGTR1 active site residues
ZINC70666587Natural compoundSimilar to established inhibitorsMultiple AGTR1 active site residues
ZINC06624086Natural compoundSimilar to established inhibitorsMultiple AGTR1 active site residues
ZINC95486187Natural compoundSimilar to established inhibitorsMultiple AGTR1 active site residues

These compounds interact with crucial AGTR1 residues in molecular docking simulations, indicating their potential as AGTR1 inhibitors that could be developed into research tools . Development of bovine-specific antagonists would enable more precise investigation of AGTR1 functions in bovine systems without cross-reactivity with other angiotensin receptors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.