Recombinant Bovine Uncharacterized protein C17orf62 homolog

What is the primary structure of Bovine Uncharacterized protein C17orf62 homolog?

Bovine Uncharacterized protein C17orf62 homolog (UniProt ID: Q3SZM3) is a 187-amino acid protein with the following sequence: MYMQVETRTSSRLHLKRAPGIRSWSLLVGILSIGLAAAYYSGDSLGWKLFYVTGCLFVAVQNLEDWEEAIFNKSTGKVVLKTFSLYRKLLTLCRAGHDQVVVLLSDIRDVNVEEEKVRYF GKGYVVVLRFATGFSHPLTQSAVMGHRSDVEVIAKLITTFLELHRLESPVELSQSSDSEA DSPGDQS. The protein appears to have transmembrane regions based on the hydrophobic amino acid clusters in its sequence, suggesting it may be associated with cellular membranes. The full expression region spans positions 1-187 of the protein sequence . This sequence information is crucial for researchers designing experimental approaches for protein characterization, antibody production, or functional studies.

What is currently known about the biological function of C17orf62 homolog in bovine systems?

Currently, the biological function of C17orf62 homolog in bovine systems remains largely uncharacterized, hence its designation as an "uncharacterized protein." The limited available data suggests that this protein may have membrane-associated functions based on its sequence characteristics. Comparative genomic analyses with homologs in other species might provide clues to its potential roles in cellular processes. Researchers should note that the pathways, protein interactions, and biochemical functions of this protein remain to be elucidated through targeted experimental approaches including knockout/knockdown studies, protein-protein interaction analyses, and subcellular localization experiments .

How does the bovine C17orf62 homolog compare structurally to its human counterpart?

The bovine C17orf62 homolog shares significant sequence similarity with its human counterpart, but specific structural differences may exist. Sequence alignment analysis reveals conserved domains that likely represent functionally important regions maintained through evolutionary pressure. Researchers investigating this protein should consider performing detailed bioinformatic analyses to identify:

• Conserved motifs between species

• Species-specific sequence variations

• Potential post-translational modification sites

• Predicted secondary and tertiary structures based on homology modeling

Understanding these structural comparisons is essential for translating findings between bovine and human systems and for designing experiments that target conserved functional domains .

What expression systems are optimal for producing soluble Recombinant Bovine C17orf62 homolog?

• Expression temperature: Lower temperatures (27-32°C) significantly improve protein solubility compared to standard 37°C expression, as demonstrated in studies with other recombinant bovine proteins.

• Inducer concentration: Moderate IPTG concentrations (0.3 mM) have shown better results for soluble protein production compared to higher concentrations (1.2 mM), which tend to produce more inclusion bodies.

• Codon optimization: Adapting the coding sequence to E. coli codon usage can improve expression and potentially increase solubility.

The table below summarizes conditions that affect solubility of recombinant bovine proteins in E. coli systems:

These parameters should be systematically tested to determine the optimal conditions for C17orf62 homolog production .

What purification strategies are most effective for Recombinant Bovine C17orf62 homolog?

For His-tagged Recombinant Bovine C17orf62 homolog, immobilized metal affinity chromatography (IMAC) provides an effective initial purification step. A comprehensive purification strategy may involve:

• Cell lysis optimization: Sonication or pressure-based disruption in the presence of protease inhibitors to prevent degradation

• IMAC purification: Using Ni-NTA or similar matrices with optimized imidazole concentrations for binding and elution

• Secondary purification: Size exclusion chromatography or ion exchange chromatography to achieve higher purity

• Buffer optimization: Final buffer exchange into Tris-based buffer with 50% glycerol for stability

Researchers should monitor protein quality at each purification stage using SDS-PAGE and consider Western blotting to confirm identity. For membrane-associated proteins like C17orf62 homolog, the addition of mild detergents during purification may improve yield of correctly folded protein .

What are the critical storage conditions for maintaining activity of purified C17orf62 homolog?

Proper storage is essential for maintaining the structural integrity and activity of Recombinant Bovine C17orf62 homolog. The optimal storage conditions include:

• Temperature: Store at -20°C for routine storage; for extended periods, -80°C is recommended

• Buffer composition: Tris-based buffer with 50% glycerol, optimized specifically for this protein

• Aliquoting strategy: Prepare small working aliquots to avoid repeated freeze-thaw cycles

• Short-term storage: Working aliquots can be maintained at 4°C for up to one week

Researchers should note that repeated freezing and thawing significantly impacts protein stability and should be avoided. For experimental reproducibility, it's advisable to document the number of freeze-thaw cycles each sample undergoes and implement consistent handling protocols across experiments .

What techniques are suitable for characterizing the post-translational modifications of Bovine C17orf62 homolog?

Characterizing post-translational modifications (PTMs) of Bovine C17orf62 homolog requires a multi-faceted approach:

• Mass spectrometry-based proteomics: High-resolution MS/MS can identify specific PTM sites and types. Consider using a combination of enrichment strategies for phosphorylation, glycosylation, or other potential modifications.

• Site-directed mutagenesis: Systematic mutation of predicted modification sites can help verify their functional significance.

• Western blotting with PTM-specific antibodies: When available, these can provide targeted detection of specific modifications.

• 2D gel electrophoresis: Different protein isoforms resulting from PTMs may be visualized as distinct spots.

Researchers should first perform in silico analysis using PTM prediction tools to identify likely modification sites before experimental verification. The integration of multiple analytical techniques provides the most comprehensive PTM characterization .

How can researchers effectively assess protein-protein interactions involving C17orf62 homolog?

To elucidate the interactome of Bovine C17orf62 homolog, researchers should consider these complementary approaches:

• Co-immunoprecipitation (Co-IP): Using antibodies against C17orf62 homolog to pull down protein complexes, followed by mass spectrometry identification of binding partners.

• Yeast two-hybrid screening: Systematic screening for binary protein interactions, though results should be validated by orthogonal methods.

• Proximity labeling approaches: BioID or APEX2 fusion proteins can identify proximal proteins in the cellular context.

• Surface plasmon resonance (SPR) or bio-layer interferometry (BLI): For quantitative measurement of binding kinetics with suspected interaction partners.

• Crosslinking mass spectrometry: To capture transient interactions and identify interaction interfaces.

Each method has strengths and limitations, and researchers should triangulate results across multiple techniques. For membrane-associated proteins like C17orf62 homolog, specialized approaches such as membrane yeast two-hybrid systems may be more appropriate than conventional methods .

What cellular localization methods best determine the subcellular distribution of C17orf62 homolog?

Determining the subcellular localization of Bovine C17orf62 homolog is crucial for understanding its function. The following complementary approaches are recommended:

• Fluorescence microscopy:

  • Immunofluorescence using specific antibodies against the native protein

  • Expression of fluorescent protein fusions (ensuring tags don't interfere with localization signals)

  • Co-localization studies with established organelle markers

• Subcellular fractionation:

  • Differential centrifugation followed by Western blotting of fractions

  • Density gradient separation of organelles

  • Specialized extraction protocols for membrane proteins

• Proximity-based labeling:

  • APEX2 or BioID fusion proteins to identify proteins in the same subcellular compartment

• Electron microscopy:

  • Immunogold labeling for high-resolution localization studies

Researchers should be aware that overexpression systems may cause artifacts, and validation using endogenous protein localization in relevant bovine cell types is highly recommended .

What strategies can be employed to investigate the physiological role of C17orf62 homolog in bovine systems?

Investigating the physiological role of this uncharacterized protein requires a multi-faceted approach:

• Gene knockdown/knockout studies:

  • RNAi or CRISPR-Cas9 approaches in bovine cell lines

  • Analysis of resulting phenotypes including growth, morphology, and response to various stimuli

  • Transcriptomic and proteomic profiling of altered cells

• Overexpression studies:

  • Controlled expression of wild-type and mutant variants

  • Assessment of cellular effects and potential dominant-negative phenotypes

• Comparative genomics:

  • Analysis of conservation across species to infer functional importance

  • Identification of co-evolved gene clusters that may share functional relationships

• Tissue expression profiling:

  • qRT-PCR, Western blotting, or immunohistochemistry across bovine tissues

  • Correlation of expression patterns with potential physiological functions

Integrating data from these complementary approaches will provide robust insights into the protein's biological role. Researchers should consider physiological context when designing experiments, including potential tissue-specific functions .

How can researchers address the challenges of studying membrane-associated proteins like C17orf62 homolog?

Membrane-associated proteins present unique experimental challenges. Based on the hydrophobic regions in the C17orf62 homolog sequence, researchers should consider:

• Solubilization strategies:

  • Screening different detergents (non-ionic, zwitterionic, etc.) for optimal extraction

  • Nanodiscs or styrene maleic acid lipid particles (SMALPs) for native-like membrane environment preservation

  • Detergent-free approaches such as amphipol stabilization

• Structural studies adaptations:

  • Crystallization trials with specific detergents or lipidic cubic phase methods

  • Cryo-EM approaches optimized for membrane proteins

  • NMR studies with isotopically labeled protein in membrane mimetics

• Functional assays:

  • Reconstitution into liposomes for transport or channel activity measurements

  • Proteoliposome-based assays for interaction studies

  • Single-molecule approaches for dynamic investigations

• Computational approaches:

  • Membrane protein topology prediction

  • Molecular dynamics simulations in lipid bilayers

The experimental design should account for the potential impact of detergents or membrane mimetics on protein structure and function .

What biochemical assays would be appropriate for investigating potential enzymatic activity of C17orf62 homolog?

Although the function of C17orf62 homolog remains uncharacterized, a systematic approach to investigate potential enzymatic activities includes:

• Activity screening panels:

  • Test for common enzymatic activities (kinase, phosphatase, protease, etc.)

  • Substrate screening using combinatorial libraries

  • Metabolite profiling in cells with altered expression levels

• Structure-based predictions:

  • In silico docking studies with potential substrates

  • Analysis of conserved motifs that may indicate enzyme class

  • Homology modeling based on structurally characterized proteins

• Targeted activity assays:

  • Design specific assays based on preliminary findings or bioinformatic predictions

  • Utilize coupled enzyme assays for detecting subtle activities

  • Consider high-sensitivity approaches such as fluorescence-based assays

• Cofactor requirements:

  • Systematic testing of metal ions, coenzymes, and other potential cofactors

  • Analysis of binding using isothermal titration calorimetry or thermal shift assays

When designing these experiments, researchers should consider the membrane association of the protein and ensure appropriate conditions for maintaining native conformation .

What strategies can overcome inclusion body formation when expressing Recombinant Bovine C17orf62 homolog?

Inclusion body formation is a common challenge when expressing recombinant proteins in E. coli. For C17orf62 homolog, multiple strategies can be employed:

• Expression condition optimization:

  • Lower induction temperature (27-32°C instead of 37°C)

  • Reduced IPTG concentration (0.3 mM has shown better results than 1.2 mM)

  • Slower induction using auto-induction media

• Genetic approaches:

  • Codon optimization for E. coli expression

  • Co-expression with molecular chaperones (GroEL/ES, DnaK/J)

  • Fusion with solubility-enhancing tags (MBP, SUMO, Thioredoxin)

• Solubilization strategies:

  • Addition of compatible solutes to the growth medium (sorbitol, glycine betaine)

  • Low concentrations of non-denaturing detergents in lysis buffer

  • In vitro refolding protocols if inclusion bodies persist

The comparison of wild-type versus codon-optimized sequences has demonstrated significant improvements in solubility for other bovine recombinant proteins, suggesting this approach would be valuable for C17orf62 homolog expression .

How can researchers validate the structural integrity of purified C17orf62 homolog?

Validating the structural integrity of purified C17orf62 homolog is critical for functional studies. Several complementary approaches are recommended:

• Biophysical characterization:

  • Circular dichroism (CD) spectroscopy to assess secondary structure content

  • Thermal shift assays to evaluate protein stability

  • Dynamic light scattering to detect aggregation and assess homogeneity

  • Limited proteolysis to probe for properly folded domains

• Activity correlation:

  • Binding assays with predicted interaction partners

  • Functional assays based on hypothesized activities

  • Comparisons with native protein isolated from bovine tissues

• Structural analysis:

  • Small-angle X-ray scattering (SAXS) for low-resolution shape information

  • NMR fingerprinting to assess tertiary structure

  • Cryo-EM for larger assemblies or complexes

These methods collectively provide evidence for proper folding and structural integrity. Researchers should establish baseline measurements for properly folded protein to serve as quality control benchmarks for subsequent preparations .

What are the most effective approaches for developing specific antibodies against Bovine C17orf62 homolog?

Developing specific antibodies against Bovine C17orf62 homolog requires strategic approaches:

• Antigen design considerations:

  • Full-length protein may be challenging due to hydrophobic regions

  • Selected peptides from predicted antigenic, solvent-exposed regions

  • Recombinant fragments representing specific domains

  • Multiple antigens to increase chances of success

• Production strategies:

  • Monoclonal antibodies for highest specificity

  • Polyclonal antibodies for robust detection across applications

  • Recombinant antibodies including single-chain variable fragments

• Validation requirements:

  • Western blotting against recombinant protein and native samples

  • Immunoprecipitation efficiency testing

  • Cross-reactivity assessment with related proteins

  • Knockout/knockdown controls to confirm specificity

• Application-specific optimization:

  • Different fixation methods for immunohistochemistry

  • Native vs. denaturing conditions for different applications

  • Epitope mapping to understand binding characteristics

Researchers should develop comprehensive validation protocols to ensure antibody specificity before using them in critical experiments, especially given the uncharacterized nature of this protein .

How might high-throughput interactomics approaches advance our understanding of C17orf62 homolog function?

High-throughput interactomics approaches offer promising avenues for functional characterization of C17orf62 homolog:

• Proximity-based interactomics:

  • BioID or APEX2 fusion proteins expressed in bovine cell lines

  • TurboID for rapid labeling of proximal proteins

  • Comparative interactome profiling across different cellular conditions

• Affinity purification-mass spectrometry:

  • Systematic AP-MS using tagged C17orf62 homolog

  • Quantitative approaches (SILAC, TMT) to distinguish specific from non-specific interactions

  • Cross-linking mass spectrometry to capture transient interactions

• Network analysis:

  • Integration with existing protein-protein interaction databases

  • Pathway enrichment analysis of identified interactors

  • Construction of functional networks based on interactome data

• Cell-type specific interactome mapping:

  • Comparison across different bovine tissues and cell types

  • Correlation with expression patterns and phenotypic data

These approaches can rapidly generate hypotheses about protein function based on the "guilt by association" principle, providing direction for focused functional studies .

What comparative genomics approaches might reveal about the evolutionary conservation and function of C17orf62 homolog?

Comparative genomics offers valuable insights into evolutionary conservation and potential functions:

• Phylogenetic analysis:

  • Construction of comprehensive phylogenetic trees across species

  • Identification of conserved domains and motifs

  • Analysis of selection pressure on different protein regions

• Synteny analysis:

  • Investigation of genomic context across species

  • Identification of conserved gene clusters suggesting functional relationships

• Co-evolution studies:

  • Detection of proteins that show coordinated evolutionary patterns

  • Identification of potential functional partners through mirror tree approaches

• Structural conservation:

  • Comparison of predicted structures across species

  • Identification of structurally conserved regions despite sequence divergence

This evolutionary perspective can provide critical clues about functional constraints and important structural features that have been maintained throughout evolution, guiding experimental design for functional studies .

How can systems biology approaches integrate diverse datasets to elucidate the role of C17orf62 homolog in cellular networks?

Systems biology approaches can integrate multiple data types to position C17orf62 homolog within cellular networks:

• Multi-omics data integration:

  • Correlation of transcriptomics, proteomics, and metabolomics data

  • Identification of conditions where C17orf62 homolog expression changes significantly

  • Network construction linking expression patterns with cellular processes

• Perturbation-based approaches:

  • Systematic analysis of cellular responses to C17orf62 homolog depletion or overexpression

  • Integration of phenotypic data with molecular changes

  • Identification of synthetic lethal or genetic interaction partners

• Mathematical modeling:

  • Development of predictive models incorporating C17orf62 homolog

  • Simulation of cellular processes with varying protein levels

  • Sensitivity analysis to determine network dependencies

• Contextual analysis:

  • Integration with tissue-specific expression data

  • Developmental and physiological context mapping

  • Disease association studies in bovine systems

These integrative approaches can position uncharacterized proteins within the broader cellular context, generating testable hypotheses about their functions and importance in cellular homeostasis .