Recombinant Bovine Uncharacterized protein C17orf78 homolog

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Uncharacterized protein C17orf78 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Protein Sequence
MDTILVFSLIITSYNVTKKELRDSSCQVEPLPDLFPKDVRSIRAELIREAQAEAKRPMFI QNQTVAILQCLGSGSKVKVNLVHSEKRQKVKHILKNLRVMTVPCRNSTAPPSCHLTPASK VQAGFLVTGKAFLPGVSQCKVYPVMGASSETYPSTTTSVTPGKKGEKTTKVDGFSSPLNQ DTDENLEKRKKWSIVVKVLIAVTLFVSGIAITVFVIFEVPCPSRCQQVRELCQCQRLRRR PRKEDQQPGTAESQSDTQPKKVGQEAPNSSSPKKAVEITVVHQTYF
Uniprot No.

Target Background

Database Links

KEGG: bta:616575

UniGene: Bt.62353

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the recommended storage and handling protocols for the recombinant protein?

For optimal stability and activity maintenance, the following protocol is recommended:

  • Store lyophilized powder at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use scenarios .

  • For reconstitution, centrifuge the vial briefly before opening, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • For long-term storage, add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) and aliquot for storage at -20°C/-80°C .

  • Working aliquots can be stored at 4°C for up to one week .

  • Storage buffer typically consists of a Tris/PBS-based buffer with 6% trehalose or 50% glycerol at pH 8.0, optimized for protein stability .

  • Avoid repeated freeze-thaw cycles as they can compromise protein integrity .

What expression systems are used for producing this recombinant protein?

Multiple expression systems can be utilized to produce Recombinant Bovine Uncharacterized protein C17orf78 homolog:

  • E. coli: The most commonly used system, offering high yield and cost-effectiveness .

  • Yeast: Alternative eukaryotic expression system that may provide different post-translational modifications .

  • Baculovirus: Insect cell-based system useful for complex proteins requiring eukaryotic processing .

  • Mammalian Cell: Provides the most native-like post-translational modifications but typically with lower yield .

  • Cell-Free Expression: Allows for rapid production without cellular constraints .

Each system offers distinct advantages depending on the experimental requirements. The recombinant protein typically achieves ≥85-90% purity as determined by SDS-PAGE analysis .

How should I design experiments to investigate the subcellular localization of Bovine C17orf78 homolog?

Based on studies of related proteins such as human C17orf80, a systematic approach to localization studies might include:

  • Immunofluorescence microscopy:

    • Express the recombinant protein fused to a fluorescent tag in bovine cells

    • Use antibodies against the His-tag or the protein itself

    • Co-stain with organelle markers (particularly mitochondrial markers, based on C17orf80 data)

    • Perform confocal microscopy analysis to determine precise subcellular distribution

  • Cell fractionation:

    • Isolate subcellular compartments (cytosol, mitochondria, nucleus, etc.)

    • Analyze the presence of C17orf78 homolog in each fraction by Western blotting

    • Include appropriate fraction markers as controls

  • Antibody accessibility assays:

    • Similar to techniques used for human C17orf80, employ selective membrane permeabilization

    • Use digitonin to permeabilize plasma membrane while keeping inner membranes intact

    • Add Triton X-100 to disrupt all cellular membranes

    • Compare staining patterns to determine membrane topology

  • Bioinformatic prediction validation:

    • Test predicted transmembrane domains experimentally

    • Investigate potential membrane association mechanisms

Human C17orf80 studies revealed mitochondrial localization with specific association with mitochondrial nucleoids, suggesting a similar approach may be valuable for the bovine homolog .

What approaches can identify potential interaction partners of C17orf78 homolog?

To elucidate the functional network of this uncharacterized protein:

  • Co-immunoprecipitation (Co-IP):

    • Leverage the His-tag for pulldown experiments from bovine cell extracts

    • Identify co-precipitating proteins by mass spectrometry

    • Validate key interactions with reverse Co-IP or Western blotting

  • Proximity labeling:

    • Create fusion constructs with BioID or APEX2 enzymes

    • Express in bovine cells to biotinylate proximal proteins

    • Purify and identify biotinylated proteins by mass spectrometry

    • This approach was successful for human C17orf80, revealing nucleoid associations

  • Yeast two-hybrid screening:

    • Use C17orf78 homolog as bait against a bovine cDNA library

    • Validate positive interactions with orthogonal methods

  • Targeted interaction studies:

    • Based on C17orf80 findings, test interactions with mitochondrial nucleoid components

    • Investigate associations with mtDNA, TFAM, and DNA replication machinery

    • Assess if interactions persist after treatment with mtDNA replication inhibitors

  • Cross-linking mass spectrometry:

    • Use chemical cross-linkers to stabilize transient protein-protein interactions

    • Map interaction interfaces at amino acid resolution

How can I assess the potential role of C17orf78 homolog in mitochondrial function?

Building on findings from human C17orf80 that demonstrated mitochondrial nucleoid association, a comprehensive approach might include:

  • Genetic manipulation:

    • Generate knockdown or knockout bovine cell lines

    • Assess effects on:

      • Mitochondrial morphology (microscopy)

      • Membrane potential (fluorescent dyes)

      • Respiration (oxygen consumption measurements)

      • ATP production (luciferase assays)

      • mtDNA copy number and integrity (qPCR)

  • Nucleoid association studies:

    • Colocalize C17orf78 homolog with nucleoid markers (TFAM, DNA)

    • Test if this colocalization persists after treatment with mtDNA replication inhibitors

    • As observed with human C17orf80, the protein may remain associated with clustered nucleoids after ethidium bromide or ddC treatment

  • Mitochondrial gene expression analysis:

    • Measure mitochondrial transcript levels

    • Assess mitochondrial protein synthesis

    • Analyze respiratory complex assembly

  • Stress response experiments:

    • Challenge cells with various stressors (oxidative stress, mtDNA depletion)

    • Monitor changes in C17orf78 homolog expression, localization, and interactions

What experimental approaches could determine if C17orf78 homolog has enzymatic activity?

To investigate potential enzymatic functions:

  • Sequence and structural analysis:

    • Perform detailed motif searches and structural predictions

    • Identify potential catalytic residues or domains

    • Compare with known enzymes to generate testable hypotheses

  • Generic enzyme activity screens:

    • Test recombinant protein with substrate libraries for common enzymatic activities

    • Screen for kinase, phosphatase, transferase, or hydrolase activities

    • Monitor substrate conversion using appropriate detection methods

  • Nucleic acid-related activities:

    • Given the association of human C17orf80 with nucleoids, test for:

      • DNA/RNA binding (electrophoretic mobility shift assays)

      • Nuclease activity (using labeled substrates)

      • DNA repair functions (using damaged DNA templates)

      • Transcription or replication roles

  • Structure-function studies:

    • Generate point mutations in predicted catalytic residues

    • Create truncation variants to isolate functional domains

    • Assess impact on activity and localization

How can I investigate potential disease associations of Bovine C17orf78 homolog?

Human C17orf80 has been linked to autism spectrum disorder and certain cancers . To explore potential disease associations of the bovine homolog:

  • Expression analysis in pathological states:

    • Compare expression levels between healthy and diseased bovine tissues

    • Focus on tissues with known pathologies that might involve mitochondrial dysfunction

    • Use quantitative PCR, Western blotting, or immunohistochemistry

  • Genetic association studies:

    • Identify single nucleotide polymorphisms (SNPs) in bovine populations

    • Correlate genetic variations with disease phenotypes or production traits

    • Perform targeted sequencing in animals with relevant disorders

  • Functional studies in disease models:

    • Create cellular models mimicking disease conditions

    • Assess changes in C17orf78 homolog expression, localization, or interactions

    • Determine if modulating the protein levels affects disease phenotypes

  • Comparative studies with human disorders:

    • Investigate functional similarities between bovine C17orf78 homolog and human C17orf80

    • Assess if findings in bovine models could inform human mitochondrial diseases

What approaches can resolve data inconsistencies in C17orf78 homolog research?

When facing contradictory results:

  • Protein quality assessment:

    • Verify protein integrity using multiple techniques (SDS-PAGE, mass spectrometry)

    • Assess proper folding using biophysical methods

    • Test different protein preparations (varying tags, expression systems)

  • Experimental condition optimization:

    • Systematically vary buffer conditions, pH, salt concentration

    • Test multiple cell types or tissue sources

    • Include appropriate positive and negative controls

  • Technical approach diversification:

    • Validate findings using orthogonal techniques

    • For localization studies, combine microscopy with biochemical fractionation

    • For interaction studies, use multiple complementary methods

  • Statistical rigor enhancement:

    • Increase biological and technical replicates

    • Perform power analysis to determine adequate sample sizes

    • Apply appropriate statistical tests and corrections

How might new technologies advance our understanding of C17orf78 homolog function?

Cutting-edge approaches that could provide new insights include:

  • AlphaFold and structural biology:

    • Generate high-confidence 3D structural models

    • Use predicted structures to identify potential functional sites

    • Design targeted mutations based on structural insights

  • CRISPR-based approaches:

    • Perform genome-wide CRISPR screens to identify genetic interactions

    • Use CRISPR base editing for precise mutagenesis

    • Create cellular models with endogenously tagged protein for physiological studies

  • Advanced imaging:

    • Apply super-resolution microscopy for detailed localization

    • Use live-cell imaging to track protein dynamics

    • Implement correlative light and electron microscopy

  • Multi-omics integration:

    • Combine proteomics, transcriptomics, and metabolomics data

    • Use systems biology approaches to place C17orf78 homolog in biological networks

    • Develop predictive models of protein function

What experimental design would best determine if bovine C17orf78 homolog shares functional similarity with human C17orf80?

To establish functional homology:

  • Complementation studies:

    • Knock down or knock out human C17orf80 in human cells

    • Express bovine C17orf78 homolog and assess rescue of phenotypes

    • Analyze if the bovine protein localizes to mitochondrial nucleoids like its human counterpart

  • Comparative interaction studies:

    • Identify interaction partners of both proteins using identical methods

    • Compare interactomes to identify shared and unique interactions

    • Focus on nucleoid components that interact with human C17orf80

  • Parallel phenotypic analysis:

    • Generate knockout cell lines for both proteins

    • Perform side-by-side phenotypic characterization

    • Use identical assays to measure effects on mitochondrial function and mtDNA maintenance

  • Domain swap experiments:

    • Create chimeric proteins containing domains from both human and bovine proteins

    • Test functionality in localization and interaction assays

    • Identify domains responsible for specific functions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.