Recombinant Bovine Uncharacterized protein C1orf185 homolog

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.

Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

The specific tag type is determined during production. If you require a particular tag, please specify this during order placement, and we will prioritize your request.
Synonyms
Uncharacterized protein C1orf185 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Protein Sequence
MASPNGFFNHLTYFLAAGAVTLGIGFFALASALWFLICKRREIFQDSKFKAVDEKCRQRP SKAKIKSHPQCVFISRNFHTGRFQSQEEQRKKETACIKANNGYSKDDFCLATKKVICDPS ESSSATNPSSVTLSLSTLPSDFYYSQSVEIADDWYSDDSQMKKSPSMPFLGEPLMEKVFS YLTTIPLEQCTENVLNMTLRDDQKDDNLKEIFTQRNTEVEIQNLQHNTE
Uniprot No.

Target Background

Database Links

KEGG: bta:768020

UniGene: Bt.71188

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What expression systems are most effective for producing this protein?

E. coli represents the established expression system for producing Recombinant Bovine Uncharacterized protein C1orf185 homolog, as documented in current research . When designing expression strategies, researchers should consider several optimization parameters:

  • Vector selection: Utilize vectors with strong promoters (T7 or similar) for high-level expression

  • E. coli strain: BL21(DE3) or Rosetta strains are recommended for recombinant protein production

  • Induction conditions: Optimize IPTG concentration, temperature, and duration to maximize yield while maintaining solubility

  • Affinity tags: The N-terminal His-tag facilitates purification through immobilized metal affinity chromatography (IMAC)

While bacterial systems are currently documented for this protein, advanced research questions might benefit from exploring alternative expression platforms:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, established protocolsLimited post-translational modifications
Mammalian cellsNative-like post-translational modificationsHigher cost, lower yield, longer timeline
Insect cellsBetter folding of complex proteinsModerate cost, moderate yield
YeastBalance between yield and eukaryotic processingStrain-specific optimization required

What are the optimal storage and handling conditions for this protein?

To maintain stability and functionality of the Recombinant Bovine Uncharacterized protein C1orf185 homolog, researchers should adhere to these evidence-based storage protocols:

  • Long-term storage: Store at -20°C to -80°C in aliquots to prevent repeated freeze-thaw cycles

  • Short-term storage: Working aliquots can be maintained at 4°C for up to one week

  • Storage buffer: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Cryoprotection: Addition of 5-50% glycerol (final concentration) is recommended for freeze protection

For reconstitution of lyophilized protein:

  • Centrifuge the vial briefly before opening to collect material at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to final concentration of 5-50% (default recommendation: 50%)

  • Prepare working aliquots to avoid repeated freeze-thaw cycles

What computational approaches can predict structural characteristics of Bovine C1orf185 homolog?

In the absence of experimentally determined structures, researchers can employ a systematic computational workflow to predict structural features:

  • Primary sequence analysis:

    • Hydrophobicity profiling to identify potential transmembrane regions

    • Charge distribution analysis to predict surface-exposed regions

    • Detection of conserved motifs through multiple sequence alignment

  • Secondary structure prediction:

    • Utilize algorithms like PSIPRED, JPred, or GOR to predict α-helices, β-sheets, and random coils

    • Estimate secondary structure content percentages

  • Tertiary structure modeling:

    • Homology modeling if suitable templates exist

    • Ab initio modeling approaches like AlphaFold2

    • Structure validation using Ramachandran plots and quality assessment tools

Similar in silico approaches have been successfully applied to other bovine proteins, such as BPV E6 recombinant proteins, where alignment and identity matrix analysis revealed key structural insights :

NucleotideCodonAmino acid
PositionRef. → Rec.Ref. → Rec.
48T → CGAU → GAC
73A → TACA → UCA
78A → GGAA → GAG
155T → CAUU → ACU

What experimental techniques are most appropriate for structural characterization?

Researchers investigating the structural properties of Bovine C1orf185 homolog should consider a multi-technique approach:

  • Circular dichroism (CD) spectroscopy:

    • Far-UV CD (190-250 nm) for secondary structure estimation

    • Near-UV CD (250-350 nm) for tertiary structure fingerprinting

    • Thermal denaturation to assess stability and folding transitions

  • Nuclear Magnetic Resonance (NMR) spectroscopy:

    • 1D proton NMR for initial structural assessment

    • 2D/3D NMR for more detailed structural information if protein size permits

    • Chemical shift analysis to identify secondary structure elements

  • X-ray crystallography:

    • Crystallization screening with varying precipitants, buffers, and additives

    • Diffraction data collection and structure determination

  • Cryo-electron microscopy:

    • Single-particle analysis for higher molecular weight complexes

    • Structural determination at near-atomic resolution

  • Limited proteolysis:

    • Identification of stable domains and flexible regions

    • Mass spectrometry analysis of proteolytic fragments

What approaches can elucidate the function of this uncharacterized protein?

Given the limited functional information available for Bovine C1orf185 homolog, researchers should implement a systematic functional characterization strategy:

  • Localization studies:

    • Fluorescent protein tagging (GFP/mCherry) for live-cell imaging

    • Immunofluorescence with subcellular markers

    • Biochemical fractionation followed by western blotting

  • Expression profiling:

    • RT-qPCR across tissues and developmental stages

    • RNA-seq data analysis from bovine tissue repositories

    • Western blot analysis of protein expression patterns

  • Loss-of-function studies:

    • siRNA or shRNA-mediated knockdown

    • CRISPR-Cas9 genome editing to generate knockout cell lines

    • Phenotypic analysis of knockout cells (morphology, proliferation, metabolism)

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with candidate interactors

    • Affinity purification-mass spectrometry (AP-MS)

    • Proximity labeling techniques (BioID, APEX2)

    • Yeast two-hybrid screening of bovine cDNA libraries

When performing gene expression studies in bovine tissues, researchers should select appropriate reference genes for normalization. Based on systematic evaluation, RPS9 and SUZ12 have been identified as stable reference genes in bovine caruncular epithelial cells under hormonal treatments :

Gene NameGene Stability ValueExpression Stability
RPS90.076Most stable
SUZ120.076Most stable
CNOT110.081Stable
ACTR1A0.082Stable
HDAC10.090Less stable
HPRT10.094Least stable

How might epigenetic modifications influence expression of Bovine C1orf185 homolog?

The rat homolog of C1orf185 (C5h1orf185) shows altered methylation and expression patterns in response to environmental chemicals, suggesting epigenetic regulation is relevant for this gene family . Researchers investigating epigenetic regulation should consider:

  • DNA methylation analysis:

    • Bisulfite sequencing of the promoter region

    • Methylation-specific PCR

    • Response to DNA methyltransferase inhibitors (e.g., 5-azacytidine)

  • Environmental/chemical responses:

    • As observed in the rat homolog, investigate responses to:

      • Benzo[a]pyrene (increases methylation)

      • Fulvestrant (increases methylation)

      • Bisphenol A (decreases expression)

  • Chromatin modification analysis:

    • ChIP-seq for histone modifications

    • ATAC-seq for chromatin accessibility

    • Treatment with histone deacetylase inhibitors

  • Experimental design considerations:

    • Use multiple cell types relevant to bovine physiology

    • Include appropriate time points to capture dynamic changes

    • Employ both genomic and gene-specific approaches

What techniques can validate the functional activity of the recombinant protein?

Validating functional activity of an uncharacterized protein presents unique challenges. Researchers should implement a comprehensive validation strategy:

  • Structural integrity assessment:

    • Circular dichroism spectroscopy for secondary structure

    • Thermal shift assays for stability

    • Size exclusion chromatography for oligomeric state

    • Limited proteolysis to identify stable domains

  • Binding partner validation:

    • Surface plasmon resonance (SPR) for binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Pull-down assays with candidate interactors

  • Cellular activity validation:

    • Complementation assays in knockout cells

    • Target engagement in cellular contexts

    • Downstream signaling pathway analysis

  • Species-specific validation:

    • Cross-reactivity with antibodies against native bovine protein

    • Functional comparison with native protein from bovine tissues

    • Species-specific binding partner analysis

How does bovine C1orf185 homolog compare to its human counterpart?

Understanding the evolutionary relationship between bovine and human C1orf185 provides insights into conserved functions and species-specific adaptations:

  • Sequence comparison:

    • Pairwise sequence alignment between bovine (Q2M2T8) and human C1orf185

    • Conservation analysis of functional domains

    • Identification of species-specific sequence variations

  • Structural comparison:

    • Comparative modeling of both proteins

    • Superimposition of predicted structures

    • Analysis of surface properties and electrostatic potential

  • Expression pattern comparison:

    • Analysis of tissue-specific expression profiles

    • Developmental regulation patterns

    • Response to physiological stimuli in both species

  • Post-translational modification prediction:

    • Conservation of modification sites between species

    • Species-specific modification patterns

    • Functional implications of differential modifications

What evolutionary insights can be gained from C1orf185 homolog analysis across species?

Evolutionary analysis of C1orf185 homologs across multiple species can reveal:

  • Phylogenetic relationships:

    • Construction of phylogenetic trees

    • Estimation of evolutionary distances

    • Identification of clades and evolutionary patterns

  • Selection pressure analysis:

    • dN/dS ratio calculation to identify positively selected sites

    • Conservation analysis to identify functionally critical regions

    • Lineage-specific adaptation patterns

  • Domain architecture evolution:

    • Tracing the gain/loss of functional domains

    • Identification of ancestral protein features

    • Correlation with species-specific physiological adaptations

  • Correlation with physiological differences:

    • Relationship between protein variations and species physiology

    • Adaptation to different environmental niches

    • Functional specialization in different species

What are the challenges in purifying Recombinant Bovine C1orf185 homolog with high purity?

  • Expression optimization:

    • Induction conditions (temperature, IPTG concentration, duration)

    • E. coli strain selection

    • Codon optimization of the expression construct

  • Solubility enhancement:

    • Buffer optimization (pH, salt concentration, additives)

    • Co-expression with chaperones

    • Use of solubility tags (MBP, SUMO) if necessary

  • Multi-step purification strategy:

    • Initial IMAC purification using the His-tag

    • Secondary purification using size exclusion chromatography

    • Ion exchange chromatography for charge-based separation

    • Hydrophobic interaction chromatography if appropriate

  • Quality control metrics:

    • SDS-PAGE with densitometry for purity assessment

    • Western blotting for specificity

    • Mass spectrometry for identity confirmation

    • Dynamic light scattering for homogeneity analysis

What methods can improve protein yield while maintaining native conformation?

Researchers aiming to optimize yield while preserving native structure should implement:

  • Expression condition screening:

    • Lower induction temperature (16-25°C) to slow expression and improve folding

    • Reduced IPTG concentration (0.1-0.5 mM)

    • Extended expression time at lower temperatures

    • Addition of compatible solutes (glycine betaine, trehalose)

  • Extraction optimization:

    • Gentle lysis methods (enzymatic lysis, freeze-thaw)

    • Buffer optimization with stabilizing additives

    • Addition of protease inhibitors

    • Reduced mechanical stress during homogenization

  • Chromatography optimization:

    • Gradient elution to improve separation

    • Optimized flow rates to maintain protein integrity

    • Column selection based on protein properties

    • Buffer composition that maintains native structure

  • Stability enhancement:

    • Addition of stabilizing agents (glycerol, trehalose)

    • pH optimization based on isoelectric point

    • Prevention of oxidation (reducing agents, anaerobic conditions)

    • Temperature control throughout purification

How can this protein be utilized in bovine reproductive biology research?

Given that related proteins like C5h1orf185 (rat homolog) show responses to hormonal treatments , Recombinant Bovine C1orf185 homolog may have applications in reproductive biology:

  • Placental function studies:

    • Expression analysis in caruncular epithelial cells

    • Response to progesterone, estrogen, and prostaglandin F2α

    • Role in maternal-fetal communication

  • Pregnancy establishment and maintenance:

    • Expression changes during early pregnancy

    • Potential role in implantation or placentation

    • Response to pregnancy-associated hormones

  • Methodological considerations:

    • Use established reference genes (RPS9 and SUZ12) for expression normalization in reproductive tissues

    • Compare expression patterns between normal and compromised pregnancies

    • Integrate with transcriptomic and proteomic approaches

What emerging technologies could advance our understanding of this protein?

Future research on Bovine C1orf185 homolog could leverage cutting-edge technologies:

  • CRISPR-based approaches:

    • Gene editing for functional studies

    • CRISPRi/CRISPRa for expression modulation

    • CRISPR screening for pathway identification

  • Single-cell technologies:

    • scRNA-seq for cell-type specific expression patterns

    • Spatial transcriptomics for tissue localization

    • Single-cell proteomics for protein-level analysis

  • Structural biology advances:

    • Cryo-EM for structure determination

    • Integrative structural biology approaches

    • Computational structure prediction with AI tools

  • Systems biology integration:

    • Multi-omics data integration

    • Network analysis of protein interactions

    • Pathway modeling and simulation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.