Recombinant Bovine Uncharacterized protein C1orf43 homolog

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Bovine Uncharacterized protein C1orf43 homolog is a protein that is a homolog to the Uncharacterized protein C1orf43 . The source organism is Bos taurus (Bovine) . The protein's recommended name is Uncharacterized protein C1orf43 homolog . The Uniprot number is Q5E943 . Gene Ontology (GO) annotations related to the corresponding human gene, C1orf43, include oxidoreductase activity .

Production and Characteristics

This protein is produced as a recombinant protein . The tag type is determined during the production process . It is supplied in a Tris-based buffer with 50% glycerol, optimized for the protein . It is recommended to store it at -20℃, or for extended storage, conserve at -20℃ or -80℃ . Repeated freezing and thawing is not recommended, and working aliquots should be stored at 4℃ for up to one week . The protein sequence is full length, corresponding to the expression region 1-253 . The AA sequence is: MASGSNWLSGVNVVLVMAYGSLVFVLLFIFVKRQIMRFAMKSRRGPHVPVGHNAPKDLKEEIDIRLSKVQDIKYEPQLLADDDARLLQLETQGNHNCYNYLYRMKALDAIRASEIPFHAEGRHPHSLMGKNFRSYLLDLRNTSTPFKGVRKALIDTLLDGYETARYGTGVFGLSEYLRYQEALSELATVVKARSGSSQRQHQSAAKDLTQSPEVSPTTIQVTYLPSSQKSKRAKHFLELKSFKDNYNTLESTL .

Similarity to Coronavirus Proteins

Human coronavirus OC43 (HCoV-OC43) and bovine coronavirus (BCoV) exhibit notable antigenic and genetic similarities . Molecular clock analysis suggests a relatively recent zoonotic transmission event, dating their most recent common ancestor to around 1890 . The highest degree of similarity is demonstrated between HCoV-OC43 and BCoV in all open reading frames (ORFs) with the exception of the E gene .
The following table illustrates the nucleotide and amino acid similarity percentages between HCoV-OC43 ORFs and other group 2 coronaviruses :

HCoV-OC43 ORF% Nucleotide (amino acid) similarity
BCoV
ORF1a97.4 (97.0)
ORF1b97.8 (98.6)
ns295.1 (95.0)
HE96.7 (95.3)
S93.5 (91.4)
ns12.996.1 (93.6)
E98.0 (96.4)
M94.8 (94.3)
N96.8 (96.4)
Ia/Ib c97.1 (ND)

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
Protein C1orf43 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-253
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Protein Sequence
MASGSNWLSGVNVVLVMAYGSLVFVLLFIFVKRQIMRFAMKSRRGPHVPVGHNAPKDLKE EIDIRLSKVQDIKYEPQLLADDDARLLQLETQGNHNCYNYLYRMKALDAIRASEIPFHAE GRHPHSLMGKNFRSYLLDLRNTSTPFKGVRKALIDTLLDGYETARYGTGVFGLSEYLRYQ EALSELATVVKARSGSSQRQHQSAAKDLTQSPEVSPTTIQVTYLPSSQKSKRAKHFLELK SFKDNYNTLESTL
Uniprot No.

Target Background

Function

Recombinant Bovine Uncharacterized protein C1orf43 homolog is a general regulator of phagocytosis. It is essential for the uptake of Gram-negative bacteria by macrophages.

Database Links
Subcellular Location
Membrane; Single-pass membrane protein. Golgi apparatus. Mitochondrion.

Q&A

What are the homologs of Bovine C1orf43 in other species?

The Bovine C1orf43 homolog has orthologs across multiple species, with varying degrees of sequence conservation:

SpeciesGene SymbolUniProt ID
Bovine (Bos taurus)C3H1orf43Q5E943
Human (Homo sapiens)C1orf43Not specified in results
Mouse (Mus musculus)4933434E20RikNP_001274016.1
Rat (Rattus norvegicus)LOC361985NP_001014196.1
Chimpanzee (Pan troglodytes)C1H1orf43XP_001150543.1
Chicken (Gallus gallus)C25H1ORF43NP_001026761.1
Zebrafish (Danio rerio)zgc:123238NP_001032189.1
Dog (Canis lupus familiaris)C7H1orf43XP_852286.1

The level of sequence conservation between C. elegans, D. melanogaster, and human orthologs is approximately 15-20% identity .

What expression systems are suitable for producing recombinant Bovine C1orf43 homolog?

The recombinant Bovine C1orf43 homolog has been successfully expressed in E. coli expression systems . The protocol typically involves:

  • Cloning the full-length coding sequence (corresponding to amino acids 1-253) into an appropriate expression vector

  • Adding an N-terminal His-tag for purification purposes

  • Transforming the construct into E. coli cells

  • Inducing expression under optimized conditions

  • Purifying the recombinant protein using affinity chromatography

The resulting protein shows greater than 90% purity as determined by SDS-PAGE .

How should the recombinant protein be purified to maintain its activity?

For optimal purification of recombinant Bovine C1orf43 homolog:

  • Harvest bacterial cells after induction

  • Lyse cells using appropriate buffer systems

  • Perform His-tag-based affinity chromatography

  • Elute the protein using a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0

  • Consider using glycerol (5-50% final concentration) for long-term storage

The protein is typically obtained in lyophilized powder form after purification . To ensure quality control, SDS-PAGE analysis should be performed to confirm purity (>90% is standard) .

What is the predicted cellular localization and function of Bovine C1orf43 homolog?

While the specific function of the Bovine C1orf43 homolog remains uncharacterized, studies of its human ortholog (C1orf43) provide insight into potential functions:

  • Cellular Localization: The human ortholog localizes to endoplasmic reticulum-plasma membrane (ER-PM) contact sites .

  • Membrane Junctions: C1orf43 appears to be important for ER-PM contact site stability, as siRNA knockdown of C1orf43 in HeLa cells resulted in collapse of ER-PM junctions .

  • Lipid Transfer: Based on studies of orthologs, the protein may be involved in lipid transfer functions at ER-PM contact sites, potentially as part of a larger protein complex .

  • Phagocytosis Regulation: The human ortholog was identified in a genome-wide CRISPR screen as a regulator of phagocytosis of Legionella pneumophila in macrophages .

Researchers should note that these functional insights are derived from studies of orthologs and should be experimentally verified for the bovine protein.

How can I validate the structural integrity of recombinant Bovine C1orf43 homolog?

To validate structural integrity:

  • SDS-PAGE Analysis: Confirm the protein migrates at the expected molecular weight (~28 kDa plus the His-tag).

  • Western Blotting: Use anti-His antibodies or specific antibodies against the C1orf43 homolog.

  • Mass Spectrometry: Verify the full-length protein sequence, particularly important for this previously uncharacterized protein.

  • Circular Dichroism (CD): Assess secondary structure content to ensure proper folding.

  • Size Exclusion Chromatography: Evaluate whether the protein exists as a monomer or forms higher-order structures.

For transmembrane proteins like C1orf43 homolog, additional validation using membrane extraction assays may be useful to confirm proper folding and membrane integration capabilities.

How might the transmembrane nature of C1orf43 homolog affect experimental design?

The Bovine C1orf43 homolog contains transmembrane regions, which presents specific challenges for researchers:

  • Buffer Composition: Consider detergent-containing buffers for extraction and purification. The amino acid sequence suggests hydrophobic segments that may require specialized extraction conditions.

  • Reconstitution Protocols: Special attention should be paid to reconstitution of the lyophilized protein:

    • Centrifuge vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol (5-50% final concentration) for stability

    • Aliquot for long-term storage

  • Functional Assays: To study membrane-associated functions, consider:

    • Liposome reconstitution experiments

    • Cell-based assays examining ER-PM contact sites

    • Lipid transfer assays if investigating potential roles in lipid metabolism

  • Structural Studies: Membrane proteins present challenges for structural biology. Consider detergent screening or nanodiscs for stabilization during characterization.

What approaches can be used to investigate the potential role of Bovine C1orf43 homolog in ER-PM contact sites?

Based on findings from orthologous proteins , researchers interested in investigating ER-PM contact site functions could:

  • Fluorescence Microscopy:

    • Express tagged versions of Bovine C1orf43 homolog in appropriate cell lines

    • Co-localize with established ER-PM contact site markers (e.g., GFP::MAPPER as used for human C1orf43)

    • Perform live-cell imaging to assess dynamic behavior

  • Knockdown/Knockout Studies:

    • Use siRNA or CRISPR to reduce or eliminate expression

    • Assess impact on ER-PM contact site formation and stability

    • Analyze effects on lipid transfer between organelles

  • Proximity Labeling:

    • Fuse BioID or APEX2 to Bovine C1orf43 homolog

    • Identify proximal proteins to map the interactome at ER-PM junctions

    • Compare with known interactors of human C1orf43

  • Lipid Transfer Assays:

    • Assess the protein's potential role in bulk lipid transfer

    • Measure changes in lipid composition at contact sites following manipulation of C1orf43 homolog levels

What are the optimal storage conditions for recombinant Bovine C1orf43 homolog?

For optimal stability and activity retention:

  • Long-term Storage:

    • Store at -20°C/-80°C

    • Aliquot to avoid repeated freeze-thaw cycles

    • Include 50% glycerol in storage buffer (recommended final concentration)

  • Working Solutions:

    • Store at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles

    • Consider adding protease inhibitors if working with cell lysates

  • Reconstitution:

    • Use deionized sterile water to reconstitute to 0.1-1.0 mg/mL

    • Brief centrifugation prior to opening is recommended

    • Store in Tris/PBS-based buffer containing 6% Trehalose at pH 8.0

How can researchers overcome potential challenges when working with membrane-associated proteins like Bovine C1orf43 homolog?

Membrane proteins present unique experimental challenges:

  • Solubility Issues:

    • Consider mild detergents compatible with downstream applications

    • Test different detergent types and concentrations

    • Optimize temperature conditions during extraction and purification

  • Protein Aggregation:

    • Include stabilizing agents such as glycerol or specific lipids

    • Monitor aggregation state using dynamic light scattering

    • Consider protein engineering approaches to improve stability

  • Functional Assays:

    • Design controls that account for membrane association

    • Consider membrane mimetics for in vitro assays

    • Validate functional findings in cellular contexts

  • Structural Characterization:

    • Consider specialized approaches for membrane proteins

    • Lipid nanodiscs or detergent micelles may preserve native conformation

    • Membrane fraction isolation techniques may be necessary for activity studies

What functional insights can be gained by comparing Bovine C1orf43 homolog with its human counterpart?

Recent research on the human ortholog C1orf43 provides valuable comparative insights:

  • Cellular Localization: Human C1orf43 localizes to ER-PM contact sites, suggesting the bovine ortholog may share this localization pattern .

  • ER-PM Junction Stability: In HeLa cells, knockdown of human C1orf43 caused collapse of ER-PM junctions, indicating an important structural role .

  • Complex Formation: Human C1orf43 may be part of larger protein complexes involved in lipid transfer at membrane contact sites, suggesting the bovine protein might have similar interaction partners .

  • Phagocytosis Regulation: Human C1orf43 was identified as a regulator of phagocytosis, suggesting potential roles in cellular uptake mechanisms .

When designing experiments with Bovine C1orf43 homolog, these functional insights from the human ortholog can inform hypotheses and experimental approaches.

What experimental techniques have been successful in characterizing the function of human C1orf43 that could be applied to the bovine homolog?

Based on studies of the human ortholog :

  • Co-localization Studies:

    • Expression of tagged C1orf43 with ER-PM contact site markers

    • Confocal microscopy to analyze subcellular distribution

  • Knockdown Approaches:

    • siRNA-mediated depletion to assess functional consequences

    • Analysis of ER-PM contact site stability following knockdown

  • Protein-Protein Interactions:

    • Co-immunoprecipitation to identify interaction partners

    • Proximity labeling to map the local interactome

  • Functional Assays:

    • Phagocytosis assays to assess potential roles in cellular uptake

    • Lipid transfer assays to investigate roles in lipid metabolism

These techniques could be adapted for the bovine homolog, with appropriate controls and species-specific considerations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.