Recombinant Bovine Uncharacterized protein C1orf43 homolog is a protein that is a homolog to the Uncharacterized protein C1orf43 . The source organism is Bos taurus (Bovine) . The protein's recommended name is Uncharacterized protein C1orf43 homolog . The Uniprot number is Q5E943 . Gene Ontology (GO) annotations related to the corresponding human gene, C1orf43, include oxidoreductase activity .
This protein is produced as a recombinant protein . The tag type is determined during the production process . It is supplied in a Tris-based buffer with 50% glycerol, optimized for the protein . It is recommended to store it at -20℃, or for extended storage, conserve at -20℃ or -80℃ . Repeated freezing and thawing is not recommended, and working aliquots should be stored at 4℃ for up to one week . The protein sequence is full length, corresponding to the expression region 1-253 . The AA sequence is: MASGSNWLSGVNVVLVMAYGSLVFVLLFIFVKRQIMRFAMKSRRGPHVPVGHNAPKDLKEEIDIRLSKVQDIKYEPQLLADDDARLLQLETQGNHNCYNYLYRMKALDAIRASEIPFHAEGRHPHSLMGKNFRSYLLDLRNTSTPFKGVRKALIDTLLDGYETARYGTGVFGLSEYLRYQEALSELATVVKARSGSSQRQHQSAAKDLTQSPEVSPTTIQVTYLPSSQKSKRAKHFLELKSFKDNYNTLESTL .
Human coronavirus OC43 (HCoV-OC43) and bovine coronavirus (BCoV) exhibit notable antigenic and genetic similarities . Molecular clock analysis suggests a relatively recent zoonotic transmission event, dating their most recent common ancestor to around 1890 . The highest degree of similarity is demonstrated between HCoV-OC43 and BCoV in all open reading frames (ORFs) with the exception of the E gene .
The following table illustrates the nucleotide and amino acid similarity percentages between HCoV-OC43 ORFs and other group 2 coronaviruses :
| HCoV-OC43 ORF | % Nucleotide (amino acid) similarity |
|---|---|
| BCoV | |
| ORF1a | 97.4 (97.0) |
| ORF1b | 97.8 (98.6) |
| ns2 | 95.1 (95.0) |
| HE | 96.7 (95.3) |
| S | 93.5 (91.4) |
| ns12.9 | 96.1 (93.6) |
| E | 98.0 (96.4) |
| M | 94.8 (94.3) |
| N | 96.8 (96.4) |
| Ia/Ib c | 97.1 (ND) |
Recombinant Bovine Uncharacterized protein C1orf43 homolog is a general regulator of phagocytosis. It is essential for the uptake of Gram-negative bacteria by macrophages.
The Bovine C1orf43 homolog has orthologs across multiple species, with varying degrees of sequence conservation:
| Species | Gene Symbol | UniProt ID |
|---|---|---|
| Bovine (Bos taurus) | C3H1orf43 | Q5E943 |
| Human (Homo sapiens) | C1orf43 | Not specified in results |
| Mouse (Mus musculus) | 4933434E20Rik | NP_001274016.1 |
| Rat (Rattus norvegicus) | LOC361985 | NP_001014196.1 |
| Chimpanzee (Pan troglodytes) | C1H1orf43 | XP_001150543.1 |
| Chicken (Gallus gallus) | C25H1ORF43 | NP_001026761.1 |
| Zebrafish (Danio rerio) | zgc:123238 | NP_001032189.1 |
| Dog (Canis lupus familiaris) | C7H1orf43 | XP_852286.1 |
The level of sequence conservation between C. elegans, D. melanogaster, and human orthologs is approximately 15-20% identity .
The recombinant Bovine C1orf43 homolog has been successfully expressed in E. coli expression systems . The protocol typically involves:
Cloning the full-length coding sequence (corresponding to amino acids 1-253) into an appropriate expression vector
Adding an N-terminal His-tag for purification purposes
Transforming the construct into E. coli cells
Inducing expression under optimized conditions
Purifying the recombinant protein using affinity chromatography
The resulting protein shows greater than 90% purity as determined by SDS-PAGE .
For optimal purification of recombinant Bovine C1orf43 homolog:
Harvest bacterial cells after induction
Lyse cells using appropriate buffer systems
Perform His-tag-based affinity chromatography
Elute the protein using a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0
Consider using glycerol (5-50% final concentration) for long-term storage
The protein is typically obtained in lyophilized powder form after purification . To ensure quality control, SDS-PAGE analysis should be performed to confirm purity (>90% is standard) .
While the specific function of the Bovine C1orf43 homolog remains uncharacterized, studies of its human ortholog (C1orf43) provide insight into potential functions:
Cellular Localization: The human ortholog localizes to endoplasmic reticulum-plasma membrane (ER-PM) contact sites .
Membrane Junctions: C1orf43 appears to be important for ER-PM contact site stability, as siRNA knockdown of C1orf43 in HeLa cells resulted in collapse of ER-PM junctions .
Lipid Transfer: Based on studies of orthologs, the protein may be involved in lipid transfer functions at ER-PM contact sites, potentially as part of a larger protein complex .
Phagocytosis Regulation: The human ortholog was identified in a genome-wide CRISPR screen as a regulator of phagocytosis of Legionella pneumophila in macrophages .
Researchers should note that these functional insights are derived from studies of orthologs and should be experimentally verified for the bovine protein.
To validate structural integrity:
SDS-PAGE Analysis: Confirm the protein migrates at the expected molecular weight (~28 kDa plus the His-tag).
Western Blotting: Use anti-His antibodies or specific antibodies against the C1orf43 homolog.
Mass Spectrometry: Verify the full-length protein sequence, particularly important for this previously uncharacterized protein.
Circular Dichroism (CD): Assess secondary structure content to ensure proper folding.
Size Exclusion Chromatography: Evaluate whether the protein exists as a monomer or forms higher-order structures.
For transmembrane proteins like C1orf43 homolog, additional validation using membrane extraction assays may be useful to confirm proper folding and membrane integration capabilities.
The Bovine C1orf43 homolog contains transmembrane regions, which presents specific challenges for researchers:
Buffer Composition: Consider detergent-containing buffers for extraction and purification. The amino acid sequence suggests hydrophobic segments that may require specialized extraction conditions.
Reconstitution Protocols: Special attention should be paid to reconstitution of the lyophilized protein:
Functional Assays: To study membrane-associated functions, consider:
Liposome reconstitution experiments
Cell-based assays examining ER-PM contact sites
Lipid transfer assays if investigating potential roles in lipid metabolism
Structural Studies: Membrane proteins present challenges for structural biology. Consider detergent screening or nanodiscs for stabilization during characterization.
Based on findings from orthologous proteins , researchers interested in investigating ER-PM contact site functions could:
Fluorescence Microscopy:
Knockdown/Knockout Studies:
Use siRNA or CRISPR to reduce or eliminate expression
Assess impact on ER-PM contact site formation and stability
Analyze effects on lipid transfer between organelles
Proximity Labeling:
Fuse BioID or APEX2 to Bovine C1orf43 homolog
Identify proximal proteins to map the interactome at ER-PM junctions
Compare with known interactors of human C1orf43
Lipid Transfer Assays:
Assess the protein's potential role in bulk lipid transfer
Measure changes in lipid composition at contact sites following manipulation of C1orf43 homolog levels
For optimal stability and activity retention:
Long-term Storage:
Working Solutions:
Store at 4°C for up to one week
Avoid repeated freeze-thaw cycles
Consider adding protease inhibitors if working with cell lysates
Reconstitution:
Membrane proteins present unique experimental challenges:
Solubility Issues:
Consider mild detergents compatible with downstream applications
Test different detergent types and concentrations
Optimize temperature conditions during extraction and purification
Protein Aggregation:
Include stabilizing agents such as glycerol or specific lipids
Monitor aggregation state using dynamic light scattering
Consider protein engineering approaches to improve stability
Functional Assays:
Design controls that account for membrane association
Consider membrane mimetics for in vitro assays
Validate functional findings in cellular contexts
Structural Characterization:
Consider specialized approaches for membrane proteins
Lipid nanodiscs or detergent micelles may preserve native conformation
Membrane fraction isolation techniques may be necessary for activity studies
Recent research on the human ortholog C1orf43 provides valuable comparative insights:
Cellular Localization: Human C1orf43 localizes to ER-PM contact sites, suggesting the bovine ortholog may share this localization pattern .
ER-PM Junction Stability: In HeLa cells, knockdown of human C1orf43 caused collapse of ER-PM junctions, indicating an important structural role .
Complex Formation: Human C1orf43 may be part of larger protein complexes involved in lipid transfer at membrane contact sites, suggesting the bovine protein might have similar interaction partners .
Phagocytosis Regulation: Human C1orf43 was identified as a regulator of phagocytosis, suggesting potential roles in cellular uptake mechanisms .
When designing experiments with Bovine C1orf43 homolog, these functional insights from the human ortholog can inform hypotheses and experimental approaches.
Based on studies of the human ortholog :
Co-localization Studies:
Expression of tagged C1orf43 with ER-PM contact site markers
Confocal microscopy to analyze subcellular distribution
Knockdown Approaches:
siRNA-mediated depletion to assess functional consequences
Analysis of ER-PM contact site stability following knockdown
Protein-Protein Interactions:
Co-immunoprecipitation to identify interaction partners
Proximity labeling to map the local interactome
Functional Assays:
Phagocytosis assays to assess potential roles in cellular uptake
Lipid transfer assays to investigate roles in lipid metabolism
These techniques could be adapted for the bovine homolog, with appropriate controls and species-specific considerations.