Recombinant Bovine Uncharacterized protein C4orf32 homolog

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine Uncharacterized Protein C4orf32 Homolog

Recombinant Bovine Uncharacterized protein C4orf32 homolog is a protein-coding gene. The human version is also known as chromosome 4 open reading frame 32 or FAM241A . Orthologs of C4orf32 can be found in other species; for example, mouse (39% antigen sequence identity) and rat (53% antigen sequence identity) .

General Information

CategoryDescription
NamesC4orf32, FAM241A, 2700063A17Rik, 5730508B09Rik, C80506, hypothetical protein LOC691931, LOC691931, RIKEN cDNA 5730508B09 gene, uncharacterized protein C4orf32, uncharacterized protein C4orf32 homolog, Uncharacterized protein FAM241A
ImmunogenRecombinant Human C4orf32
Gene Accession NumberQ8N8J7

C11orf96 as a Related Protein

Although the primary focus is on C4orf32, research on related uncharacterized proteins such as C11orf96 provides insight into studying such proteins. Key findings regarding C11orf96 include :

  • Cloning and Expression: The coding sequence (CDS) region of the Felis catus, human, and mouse C11orf96 gene was cloned. The CDS region is 372 bp long, encoding 124 amino acids and is relatively conserved in different mammals .

  • Bioinformatics Analysis: C11orf96 is rich in Serine and has multiple predicted phosphorylation sites. Protein interaction prediction analysis revealed that the protein is associated with several transmembrane family proteins and zinc finger proteins .

  • Tissue Distribution: C11orf96 is distributed in all tissues and organs, with the highest expression levels in the kidney, suggesting it may play a specific biological role in the kidney .

  • Protein Characteristics: The protein consists of four structures: α-helix (61%), β-turn (4%), random coil (33%), and extended chain (2%). Protein interaction prediction analysis showed that the C11orf96 protein may interact with multiple proteins in the host, including the TMEM117 transmembrane protein that regulates endoplasmic reticulum (ER) stress, several other transmembrane proteins, E3 ubiquitin ligase, and zinc finger proteins .

Functionality

Proteins such as C4orf32 and C11orf96 may have roles in cellular processes such as ER stress, protein ubiquitination modification, and gene transcription . Further research is needed to fully elucidate the functions of C4orf32.

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FAM241A; Uncharacterized protein FAM241A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
FAM241A
Target Protein Sequence
MCSAGQLLGGGGGGGGSGGERDEDRDALAERAAAGTEQESGASPRRRGRRPLEEREQDIE ESQNHTGEPVGDDYKKMGTLFGELNKSLLNMGFTRMYFGEQIVEPVIVIFFWVMLWFLGL PAFGLVALLCLVIIYVQQ
Uniprot No.

Target Background

Database Links

KEGG: bta:767842

UniGene: Bt.44263

Protein Families
FAM241 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is C4orf32 and what is its current nomenclature?

C4orf32 (Chromosome 4 Open Reading Frame 32) is a protein-coding gene that has been renamed to FAM241A (Family with sequence similarity 241 member A) . This protein was initially identified as an uncharacterized protein, with gene accession number Q8N8J7. The gene symbols associated with it include FAM241A, 2700063A17Rik, 5730508B09Rik (in mouse models), and various other identifiers depending on the organism and database .

What are the known orthologs of C4orf32 across species?

C4orf32 has several documented orthologs across species. The mouse ortholog shows approximately 39% sequence identity with human C4orf32, while the rat ortholog demonstrates approximately 53% identity . In research literature, the chicken ortholog is referred to as cC4orf32 and the mouse ortholog as mC4orf32 or 5730508B09Rik . These orthologs have been instrumental in comparative genomic studies investigating evolutionary conservation and function.

What is known about the protein structure and immunogen sequence?

The immunogen sequence used for antibody production against human C4orf32 includes: "GERDEDGDALA EREAAGTEWD PGASPRRRGQ RPKESEQDVE DSQN" . This sequence shows varying degrees of conservation across species, which is relevant when conducting cross-species studies. The complete protein structure remains incompletely characterized, which presents both challenges and opportunities for structural biology research.

What are optimal methods for detecting C4orf32 expression in tissue samples?

For detecting C4orf32/FAM241A in tissue samples, immunocytochemistry using polyclonal antibodies has proven effective . When designing experiments:

  • Use antibodies stored at 4°C for short term or -20°C for long term storage, avoiding freeze/thaw cycles

  • Employ antigen retrieval methods appropriate for formalin-fixed tissues

  • Use recommended buffer conditions: PBS with 40% glycerol and 0.02% sodium azide at pH 7.2

  • Apply antibody at the validated concentration of 0.2 mg/mL

  • Include appropriate positive and negative controls, particularly important for less-characterized proteins

How can I design effective 3D-FISH experiments to study C4orf32 genomic architecture?

Based on published methodologies for chromatin architecture studies involving C4orf32 :

  • Design DNA probes spanning 15-20kb regions to maximize resolution

  • For human studies, focus on chromosome 4 where C4orf32/FAM241A is located

  • Include probes for functionally related genes (e.g., Pitx2, Playrr) to analyze spatial relationships

  • Quantify interprobe distances using 3D image analysis software

  • Compare results across different cell types and developmental stages

The genomic distances analyzed should be resolvable via interphase FISH (50-100kb), with optimally designed probes under 25kb for maximum resolution .

What controls should be included when working with recombinant bovine C4orf32?

When designing experiments with recombinant bovine C4orf32 homolog:

  • Include species-matched negative controls to account for non-specific binding

  • Verify protein identity through mass spectrometry or N-terminal sequencing

  • Test functionality using both bovine and cross-species cellular models

  • Assess potential post-translational modifications that may differ between native and recombinant proteins

  • Include concentration gradients to determine optimal working concentrations for your specific application

How does C4orf32 participate in three-dimensional chromatin organization?

Analysis of C4orf32's role in chromatin architecture has revealed significant insights:

  • C4orf32 participates in long-range looping that brings distantly located genomic regions into close proximity

  • In chicken dorsal mesentery (DM), cC4orf32 and Playrr were found to be significantly closer to Pitx2 than to each other, despite larger genomic distances separating them

  • This striking interaction brings far-separated genes (416 kb and 578 kb) into closer spatial proximity than genes separated by just 160 kb

  • The looping architecture positions the proximal and distal ends of the gene desert in close 3D proximity

  • This spatial organization appears to be part of a topologically associating domain (TAD) with functional implications for gene regulation

What is known about the asymmetric chromatin architecture involving C4orf32?

Research has demonstrated subtle but significant left-right differences in the spatial organization of chromatin involving C4orf32:

  • In chicken DM, researchers identified statistically significant left-right differences in interprobe distances for both cC4orf32-Pitx2 and Playrr-Pitx2

  • This demonstrates closer proximity of both cC4orf32 and Playrr to Pitx2 in the left DM compared to the right

  • These differences mirror asymmetric gene expression patterns - proximity of cC4orf32 and Playrr to Pitx2 in left DM nuclei is associated with preferential transcription of Pitx2

  • In the right DM, where cC4orf32 and Playrr are expressed, they are further separated from Pitx2

  • These findings suggest that subtle local shifts in the positioning of genes, rather than global differences in locus topology, contribute to asymmetric gene expression

How conserved is the spatial organization of C4orf32 across species?

Comparative studies between chicken and mouse models have revealed remarkable conservation of spatial chromatin organization:

SpeciesGenomic Distance RelationshipsSpatial OrganizationExpression Pattern
ChickencC4orf32-Playrr: 162kb; cC4orf32-Pitx2: 578kb; Playrr-Pitx2: 416kbcC4orf32 and Playrr closer to Pitx2 than to each otherLeft-right asymmetric proximity
MousemC4orf32-Playrr: 380kb; mC4orf32-Pitx2: 1.36Mb; Playrr-Pitx2: 980kbSimilar organization despite larger genomic distancesmC4orf32 shows bilateral expression

Despite significant differences in genomic distances between species, the Playrr-Pitx2 interprobe distance was nearly identical in chicken and mouse, highlighting evolutionary conservation of this spatial relationship .

What developmental processes involve C4orf32?

C4orf32 appears to be involved in developmental processes related to left-right asymmetry:

  • In both chicken and mouse models, C4orf32's spatial relationship with Pitx2 correlates with asymmetric gene expression patterns

  • These molecular asymmetries are associated with transcriptional and morphological asymmetries that drive processes such as gut looping

  • The conserved nature of these spatial relationships across species suggests fundamental importance in developmental regulation

  • The interactions between C4orf32, Playrr, and Pitx2 may contribute to proper establishment of organ laterality during embryonic development

How can genomic proximity data be integrated with expression analysis?

To effectively integrate genomic proximity data with expression analysis:

  • Collect 3D-FISH data to measure interprobe distances between C4orf32 and functionally related genes

  • Simultaneously measure transcript levels using RT-qPCR or RNA-seq from the same or comparable samples

  • Analyze correlation between spatial proximity and expression levels

  • Consider chromatin state information (open/closed) from ATAC-seq or similar approaches

  • Complement with protein-DNA interaction data (ChIP-seq) to identify potential regulatory mechanisms

What approaches can reliably distinguish between functional and coincidental genomic proximity?

Distinguishing functional from coincidental genomic proximity requires multiple complementary approaches:

  • Perform perturbation experiments (CRISPR/Cas9-mediated deletion or disruption) of specific regions

  • Analyze effects on both spatial organization and gene expression

  • Investigate consistency across different cell types and developmental stages

  • Compare with available Hi-C and ChIA-PET data to validate interactions

  • Examine evolutionary conservation of spatial relationships as evidence of functional importance

What are common challenges when working with antibodies against uncharacterized proteins like C4orf32?

Researchers face several challenges when using antibodies against proteins like C4orf32:

  • Limited validation data compared to well-characterized proteins

  • Potential cross-reactivity with related protein family members

  • Variability between antibody lots and manufacturers

  • Difficulty in establishing appropriate positive and negative controls

  • Potential species-specific differences in epitope recognition

To address these challenges, researchers should perform comprehensive validation using multiple detection methods and include appropriate controls in each experiment.

How can I optimize 3D-FISH protocols for studying C4orf32 genomic architecture?

Based on published methodologies:

  • Design probes that span genomic intervals of less than 25kb for maximum resolution

  • For chicken studies, consider probes spanning chr4:56,825,232–56,849,123 for cC4orf32

  • For mouse studies, consider probes spanning chr3:127,846,052–127,861,644 for mC4orf32

  • Use multi-color labeling schemes (e.g., Cy5 for C4orf32, DIG for Playrr, Cy3 for Pitx2)

  • Analyze multiple biological replicates (minimum of five) to ensure reproducibility of subtle spatial differences

What statistical approaches are appropriate for analyzing 3D chromatin interaction data?

When analyzing 3D chromatin interaction data involving C4orf32:

  • Use statistical tests appropriate for distance measurements (t-tests or non-parametric alternatives)

  • Account for cellular heterogeneity within tissue samples

  • Consider multiple hypothesis testing correction when analyzing multiple gene pairs

  • Evaluate reproducibility across biological replicates

  • Compare with genome-wide interaction data (Hi-C, ChIA-PET) for validation of specific interactions

What are promising approaches for elucidating C4orf32 function?

Future research directions for understanding C4orf32 function include:

  • Comprehensive protein interactome studies to identify binding partners

  • CRISPR/Cas9-mediated functional studies to assess developmental consequences of C4orf32 disruption

  • High-resolution structural biology approaches to determine protein structure

  • Single-cell analyses to evaluate cell-type specific roles

  • Systems biology approaches integrating spatial genomics with transcriptomics and proteomics data

How might C4orf32 research contribute to understanding broader biological processes?

C4orf32 research has potential implications for understanding:

  • Mechanisms underlying three-dimensional genome organization

  • Principles of developmental left-right asymmetry

  • Evolution of conserved regulatory genomic architecture

  • Relationships between spatial chromatin organization and gene expression

  • Potential roles in pathological conditions associated with defects in left-right asymmetry

What technological advances would accelerate C4orf32 research?

Emerging technologies that could advance C4orf32 research include:

  • Live-cell imaging of chromatin dynamics to observe spatial relationships in real-time

  • CRISPR-based genomic tagging for endogenous visualization

  • Multiplexed FISH approaches allowing simultaneous visualization of many genomic loci

  • Integration of spatial transcriptomics with chromatin architecture data

  • Machine learning approaches for predicting functional significance of spatial interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.